Recombinant Staphylococcus epidermidis Signal transduction histidine-protein kinase ArlS (arlS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus epidermidis Signal Transduction Histidine-Protein Kinase ArlS (ArlS)

Staphylococcus epidermidis is a bacterium known for its ability to adapt to different environments through two-component systems like ArlRS . ArlS, or Signal transduction histidine-protein kinase ArlS, functions as a sensor protein kinase and a component of the ArlRS two-component regulatory system . This system impacts various bacterial processes, including adhesion, autolysis, multidrug resistance, and virulence .

ArlS and the ArlRS Two-Component System

In a typical two-component system, a histidine kinase (HK) such as ArlS, which is a transmembrane protein, interacts with a response regulator (RR), which is a cytoplasmic DNA binding protein . It has been assumed that ArlS senses and activates ArlR in response to these stimuli . The histidine kinase senses environmental changes and then signals to the response regulator to initiate the appropriate cellular response .

Role of ArlS in Nutrient Availability

ArlS is essential for the activation of ArlR in response to the immune effector calprotectin and glucose limitation . Research indicates that ArlS is required to activate ArlR when manganese is sequestered by the host immune system and when glucose is limited . Even though ArlR retains some activity without ArlS, it cannot respond to manganese or glucose availability without its cognate histidine kinase . ArlS phosphotransfer to ArlR is also needed for S. aureus to resist metal starvation imposed by calprotectin .

ArlS and Virulence

The ArlRS system, including ArlS, has a global regulatory effect on S. aureus virulence, autolysis, slime layer formation, cell aggregation, and biofilm development in vitro . The absence of ArlRS in S. epidermidis can abolish biofilm production, underscoring its importance in biofilm-associated diseases .

ArlS as a Drug Target

Histidine kinases like ArlS are attractive targets for drug development because their autophosphorylation is mediated via the conserved catalytic and ATP-binding domain that contains a typical substrate binding pocket, which may be suitable for drug screening . Tilmicosin, an FDA-approved drug, has been found to inhibit ArlS histidine kinase activity, suggesting that inhibiting ArlS could be a viable strategy to combat S. aureus infections .

ArlS and Cross-Talk with Other Systems

While histidine kinases and response regulators typically operate as a pair, cross-talk between different two-component systems can occur . For instance, the histidine kinase GraS can also activate ArlR, which raises questions about the specific role of ArlS in response to manganese and glucose limitation .

Functional Analysis of ArlS

Experiments using reporter fusions under the control of mgrA-P2 have demonstrated the necessity of ArlS for the activation of ArlR by calprotectin (CP) . The Δ arlS mutant showed reduced mgrA-P2 activity in the absence of CP compared to wild-type bacteria .

ConditionWild Type S. aureusΔ arlS Mutant
Presence of CPSignal detectedSignal detected
Absence of CPSignal detectedReduced signal

The expression of ArlS from a plasmid restored mgrA-P2 reporter activity to wild-type levels, confirming that ArlS activates ArlR .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arlS; SERP0988; Signal transduction histidine-protein kinase ArlS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
arlS
Target Protein Sequence
MIKRQKLKYKWMLITTLITFTTILLFCLIIIFFLKDTLRSSEIDEAERSSNDIANLFHSK SLSDISALDLNASLENFQEILIYDDKGRKLIQTSNDNTLAYDNKIDFKHPERIHIHRSHG INYLVITEPIRSKEFSGYSVLVHSLQNYDNLVKSLYIVALAFGLIATIITAGVSYIFSSQ ITKPIVTMSNKMNQIRRDGFQNKLELTTNYEETDNLIDTFNEMMYQIEESFNQQRQFVED ASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEVNRITKLVEELLLLTKDRVN HNVLECENVDINSEIQSRVKSLQHLHPDYTFETHLATKPIQLKINRHQFEQLLLIFIDNA MKYDTEHKHIKIVTQLKNKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSRARSQGGNGL GLSIAEKIVQLNGGMIQVESELQNYTTFKISFPVLN
Uniprot No.

Target Background

Function
ArlS is a member of the two-component regulatory system ArlS/ArlR. It likely functions as a sensor histidine kinase, autophosphorylating at a histidine residue before transferring the phosphate group to ArlR.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ArlS protein and what is its role in Staphylococcus epidermidis?

ArlS (Q8CSL7) is a signal transduction histidine-protein kinase that functions as a sensor component in the ArlS-ArlR two-component regulatory system in Staphylococcus epidermidis. This 456-amino acid transmembrane protein contains both sensing and kinase domains that allow the bacterium to detect and respond to environmental changes through phosphorylation cascades . The protein plays a critical role in bacterial adaptation mechanisms, helping S. epidermidis transition between commensal and pathogenic lifestyles depending on environmental conditions . ArlS functions by autophosphorylating at a conserved histidine residue in response to specific stimuli and then transferring the phosphoryl group to its cognate response regulator, ArlR, which subsequently modulates gene expression . Research has suggested that ArlS may be involved in regulating various cellular processes including biofilm formation, which is particularly relevant given S. epidermidis' role as an opportunistic pathogen in nosocomial infections, especially those associated with indwelling medical devices .

How is recombinant ArlS protein typically expressed and purified for research purposes?

Recombinant ArlS protein is commonly expressed in Escherichia coli expression systems using vectors designed for histidine-tagged protein production to facilitate purification . The full-length sequence (1-456 amino acids) is typically cloned into an appropriate expression vector with an N-terminal His-tag, and expression conditions are optimized to maximize protein yield while minimizing degradation or inclusion body formation . After bacterial culture and induction, cells are typically lysed, and the recombinant protein is purified using nickel affinity chromatography, taking advantage of the histidine tag's affinity for Ni2+ ions. The purified protein is then subjected to buffer exchange and often stored as a lyophilized powder or in a Tris/PBS-based buffer containing trehalose (approximately 6%) at pH 8.0 to enhance stability . Researchers should anticipate potential challenges with membrane protein purification, as ArlS is a transmembrane protein, potentially requiring detergents or specialized protocols to maintain proper folding and functionality. Quality control typically includes SDS-PAGE analysis to confirm purity (generally >90%), and activity assays to verify functional integrity of the kinase domain .

How should researchers design experiments to study ArlS kinase activity and substrate specificity?

When designing experiments to study ArlS kinase activity and substrate specificity, researchers should employ a systematic approach that addresses multiple aspects of protein function. In vitro phosphorylation assays represent the cornerstone of such investigations, typically using purified recombinant ArlS protein in the presence of ATP (usually radiolabeled γ-32P-ATP for detection sensitivity) to assess autophosphorylation activity and phosphotransfer to potential substrates like ArlR . Experimental design should include appropriate positive and negative controls, such as known active kinases and catalytically inactive ArlS mutants (often created by substituting the conserved histidine residue), following the fundamental experimental design principles of replication, randomization, and blocking to minimize systematic errors . Researchers should consider implementing time-course experiments to determine reaction kinetics and dose-response assays with varying substrate concentrations to determine enzyme parameters like Km and Vmax. Substrate specificity can be explored through competition assays with potential substrate proteins or peptides, guided by bioinformatic predictions of interaction domains based on the ArlS sequence . More sophisticated approaches might include phosphoproteomic analyses to identify novel substrates or structural studies using techniques like X-ray crystallography or cryo-EM to elucidate the molecular basis of substrate recognition.

What are the most effective approaches for studying the ArlS-ArlR signaling pathway in the context of S. epidermidis virulence?

Studying the ArlS-ArlR signaling pathway in the context of S. epidermidis virulence requires a multi-faceted approach that integrates both molecular and phenotypic analyses. Genetic manipulation through the creation of arlS deletion mutants, complementation strains, and point mutations in key functional domains represents a foundational approach that allows researchers to directly link gene function to observable phenotypes . Phenotypic assays should assess virulence-associated characteristics including biofilm formation capacity, adhesion to relevant substrates (e.g., fibrinogen, to which S. epidermidis can bind via SdrG protein), antibiotic resistance, and survival in models mimicking host environments . Transcriptomic analyses using RNA-sequencing or microarrays can identify genes regulated by the ArlS-ArlR system, providing insight into the regulatory network and potential virulence mechanisms controlled by this pathway . In vitro infection models using relevant human cell types (e.g., keratinocytes, endothelial cells) can assess bacterial adherence, invasion, and host cell responses when wild-type and mutant strains are compared . For in vivo relevance, animal models of infection, particularly those mimicking device-associated infections, could be employed to assess the contribution of ArlS to pathogenesis in a complex host environment . Researchers should design these experiments with careful attention to replication, appropriate controls, and statistical power calculations to ensure meaningful results can be obtained .

How can researchers effectively compare ArlS function across different Staphylococcal species?

Comparative studies of ArlS function across different Staphylococcal species require thoughtful experimental design that accounts for both evolutionary conservation and species-specific adaptations. Sequence alignment and phylogenetic analysis of ArlS proteins from different Staphylococcal species should first be conducted to identify conserved domains and species-specific variations that might influence function . Heterologous expression studies, where arlS genes from different species are expressed in a common genetic background (either a model organism like E. coli or an arlS deletion mutant of one Staphylococcal species), can directly compare protein functionality through complementation assays and biochemical characterization . Researchers should develop standardized assay conditions that can be applied across species to fairly compare kinase activities, substrate specificities, and responses to environmental stimuli. Cross-species transcriptomic studies can reveal whether orthologous ArlS-ArlR systems regulate similar or divergent gene sets, providing insight into functional conservation versus adaptation . When designing such comparative experiments, researchers must consider the "size of experimental units" principle, ensuring sufficient biological replicates for each species and controlling for confounding variables such as growth rates or media preferences that might differ between species . Statistical analysis should account for these potential sources of variation and employ appropriate methods for multi-species comparisons, such as two-way ANOVA or mixed-effects models .

What are the most common challenges in recombinant ArlS expression and how can they be overcome?

Recombinant expression of ArlS presents several challenges primarily due to its nature as a transmembrane histidine kinase with both hydrophobic and hydrophilic domains. One of the most frequent issues is poor solubility or formation of inclusion bodies when expressed in E. coli, which can be addressed by optimizing induction conditions (lower temperatures of 16-25°C, reduced IPTG concentrations, and slower induction) . For transmembrane proteins like ArlS, the choice of expression system is critical; while E. coli is commonly used for its simplicity and high yield, researchers might consider membrane-protein optimized strains (like C41/C43(DE3)) or alternative systems such as cell-free expression for particularly difficult constructs . Protein degradation during expression or purification can be mitigated by including protease inhibitors throughout the process and optimizing buffer conditions to enhance stability. For functional studies, researchers often face the challenge of maintaining proper protein folding and activity, which may require the inclusion of specific lipids or detergents to mimic the native membrane environment . Expression of truncated constructs focusing on specific domains (particularly the cytoplasmic kinase domain) rather than the full-length protein can sometimes improve yield and solubility while still providing valuable functional information. Optimization of purification strategies, potentially including on-column refolding protocols or specialized chromatography methods beyond simple His-tag affinity purification, may be necessary for obtaining homogeneous, active protein preparations .

How does ArlS contribute to Staphylococcus epidermidis biofilm formation and pathogenesis?

The contribution of ArlS to S. epidermidis biofilm formation and pathogenesis represents a critical area of investigation given the organism's emergence as an "accidental pathogen" particularly in healthcare-associated infections . As a sensor histidine kinase in a two-component regulatory system, ArlS likely functions as an environmental sensor that helps S. epidermidis transition between commensal and pathogenic lifestyles by regulating genes involved in biofilm formation, adhesion, and immune evasion . Current research suggests that the ArlS-ArlR system may influence the expression of adhesins like SdrG (Fbe), a fibrinogen-binding protein that belongs to the serine/aspartate (SD) repeat family and has been implicated in catheter-associated infections . The regulatory role of ArlS may extend to controlling extracellular matrix production, including polysaccharide intercellular adhesin (PIA) and extracellular DNA release, both critical components of robust biofilm architecture. In the context of pathogenesis, ArlS-mediated signaling might modulate S. epidermidis interactions with host immune components, potentially influencing bacterial survival during infection . Interestingly, S. epidermidis has been shown to protect against colonization by the more virulent pathogen S. aureus in certain contexts, suggesting complex interspecies dynamics that might be partially regulated through sensing systems like ArlS . Future studies employing comparative transcriptomics between wild-type and arlS mutant strains under biofilm-inducing conditions will likely provide greater insight into the specific genes and mechanisms regulated by this system.

What is the potential of ArlS as a target for anti-biofilm therapeutic development?

The potential of ArlS as a target for anti-biofilm therapeutic development lies in its fundamental role as a signaling node that may regulate multiple virulence-associated pathways in S. epidermidis. Two-component systems like ArlS-ArlR are particularly attractive drug targets due to their absence in mammalian cells, potentially allowing for selective targeting without direct host toxicity . As an upstream regulator potentially controlling multiple virulence factors, inhibition of ArlS could theoretically disrupt biofilm formation processes at several levels simultaneously, providing an advantage over approaches targeting individual adhesins or matrix components . Several potential drug development strategies could be pursued: small molecule inhibitors designed to interfere with ArlS autophosphorylation activity, compounds that disrupt ArlS-ArlR interaction or phosphotransfer, or molecules that bind to the sensor domain and prevent stimulus recognition . The development pipeline would include initial high-throughput screening of compound libraries against purified recombinant ArlS protein, followed by secondary screening in cellular systems to assess effects on biofilm formation . Lead compounds would require optimization for pharmacokinetic properties and assessment in relevant animal models of device-associated infection . Potential challenges include achieving sufficient specificity to avoid affecting beneficial microbiota, developing compounds with appropriate membrane permeability to reach the target, and addressing potential resistance mechanisms that might emerge. Combination approaches targeting multiple two-component systems simultaneously might offer synergistic effects and reduce the likelihood of resistance development.

How can systems biology approaches enhance our understanding of ArlS function in the broader context of S. epidermidis regulatory networks?

Systems biology approaches offer powerful frameworks for understanding ArlS function within the complex regulatory landscape of S. epidermidis, moving beyond reductionist studies of isolated components to examine integrated network behavior. Multi-omics strategies combining transcriptomics, proteomics, and metabolomics can provide comprehensive views of cellular changes resulting from ArlS perturbation under various environmental conditions relevant to both commensal and pathogenic lifestyles . Network analysis of these datasets can reveal direct and indirect regulatory connections, identifying potential feedback loops, regulatory hubs, and emergent properties not evident from single-gene studies . Computational modeling approaches, ranging from Boolean networks to constraint-based models, can integrate experimental data to predict system behavior under novel conditions and generate testable hypotheses about ArlS function . Comparative systems analyses across multiple Staphylococcal species can illuminate evolutionary conservation and divergence in regulatory architecture, potentially revealing species-specific adaptations in ArlS function . Single-cell approaches examining gene expression heterogeneity within S. epidermidis populations can uncover potential bet-hedging strategies regulated by ArlS that might contribute to survival under stress conditions or antibiotic treatment . Cross-disciplinary integration of molecular microbiology with advanced imaging, biophysical techniques, and computational biology will increasingly be needed to fully map the ArlS regulatory network and its dynamic behavior in response to changing environments . Such comprehensive understanding could ultimately guide more effective intervention strategies targeting S. epidermidis in clinical settings.

What are the key methodological considerations for studying ArlS-ArlR interactions in vitro?

Studying ArlS-ArlR interactions in vitro requires careful attention to methodological details that preserve the physiological relevance of this dynamic signaling system. Researchers should first consider protein preparation strategies that maintain native-like conformations for both proteins; while full-length ArlS presents challenges due to its transmembrane domains, approaches like nanodisc incorporation or liposome reconstitution can provide more physiologically relevant contexts than detergent solubilization alone . Multiple complementary interaction assays should be employed, including biochemical methods like co-immunoprecipitation or pull-down assays with purified components, biophysical techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) for kinetic and thermodynamic parameters, and functional assays that directly monitor phosphotransfer . When designing experiments to measure phosphotransfer, researchers should consider time-dependent aspects of the reaction, as histidine phosphorylation is relatively labile, potentially requiring rapid sampling techniques or phosphoprotein stabilization strategies . Environmental conditions can significantly impact two-component system interactions, so researchers should systematically investigate parameters like pH, ionic strength, temperature, and potential ligands that might modulate ArlS activity or ArlS-ArlR interaction affinity . Structural approaches including X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy can provide atomic-level insights into interaction interfaces and conformational changes associated with signaling, though these typically require significant protein engineering and optimization . Throughout all studies, researchers should apply rigorous experimental design principles including appropriate controls, replication, and statistical analysis to ensure reproducible and meaningful results .

What are the emerging trends in research on bacterial two-component systems like ArlS-ArlR?

Emerging trends in bacterial two-component system research are increasingly focused on systems-level understanding and translational applications, with several key directions relevant to ArlS-ArlR investigation. There is growing interest in understanding the spatiotemporal dynamics of signaling, using advanced fluorescence microscopy and biosensor approaches to visualize phosphorylation events and protein interactions in real-time within living bacterial cells . Cross-talk and network integration are receiving increased attention, examining how systems like ArlS-ArlR interact with other signaling pathways to create coordinated cellular responses . Structural biology approaches have advanced significantly, with cryo-EM technologies now enabling visualization of intact membrane-embedded kinases like ArlS in various signaling states, potentially revealing conformational changes previously inaccessible to analysis . Single-cell analytical approaches are uncovering population heterogeneity in signaling responses, with implications for understanding bacterial persistence and antibiotic tolerance . Synthetic biology applications are expanding, with two-component systems being repurposed as biosensors or engineered to create novel cellular behaviors . There is increasing recognition of the role of two-component systems in bacterial interaction with eukaryotic hosts and other microorganisms in complex communities, with ArlS potentially involved in S. epidermidis interactions with both human cells and other skin microbiota including S. aureus . Computational approaches including molecular dynamics simulations and machine learning methods are being applied to predict ligands, interaction partners, and regulatory networks associated with histidine kinases like ArlS, accelerating discovery beyond traditional experimental approaches .

What is the potential significance of ArlS in understanding the transition of S. epidermidis from commensal to pathogen?

The potential significance of ArlS in understanding S. epidermidis' transition from commensal to pathogen lies in its likely role as an environmental sensor that helps orchestrate adaptive responses to changing conditions. S. epidermidis has been characterized as an "accidental pathogen" - not having evolved specifically to cause disease, but possessing factors that can become virulence determinants under certain circumstances, particularly in healthcare settings involving implanted medical devices . ArlS may function as a critical regulatory switch in this context, sensing specific environmental cues present in the host that signal transition opportunities from benign colonization to more invasive behaviors . By understanding the specific stimuli detected by ArlS and the downstream regulatory consequences, researchers could potentially identify critical triggers that promote pathogenesis in healthcare settings. The ArlS-ArlR system might regulate the expression of adhesins like SdrG that mediate attachment to host proteins such as fibrinogen, which becomes particularly relevant in the context of implanted devices that rapidly acquire host protein coatings . Interestingly, the dual nature of S. epidermidis as both commensal and pathogen is further complicated by findings suggesting it may protect against colonization by more virulent pathogens like S. aureus in certain populations, including people living with HIV . Understanding how ArlS-mediated signaling contributes to these complex interactions could provide insight into microbiome dynamics and potentially inform probiotic approaches leveraging beneficial aspects of S. epidermidis colonization while minimizing pathogenic potential .

How can researchers effectively translate ArlS research from laboratory findings to clinical applications?

Translating ArlS research from laboratory findings to clinical applications requires strategic approaches that bridge fundamental science with practical healthcare solutions. Researchers should establish robust translational pipelines that begin with mechanistic studies of ArlS function and extend through preclinical models to eventual clinical testing . When targeting ArlS for potential therapeutic development, researchers should conduct early feasibility assessments addressing pharmaceutical considerations like druggability, selectivity, and potential for resistance development . Collaborative networks bringing together microbiologists, structural biologists, medicinal chemists, and clinicians will be essential for successful translation, ensuring research questions remain clinically relevant and development efforts address practical healthcare needs . Animal models specifically designed to mimic human device-associated infections will be critical for validating potential interventions, with careful attention to experimental design elements that maximize clinical relevance and predictive value . Researchers should consider dual-purpose approaches that might both inhibit pathogenic potential while preserving beneficial aspects of S. epidermidis colonization, particularly given evidence suggesting protective effects against more virulent pathogens like S. aureus . Diagnostic applications represent another translational avenue, potentially using ArlS activity or expression as biomarkers for S. epidermidis strains with enhanced pathogenic potential . Beyond traditional drug development, innovative approaches like antivirulence strategies that specifically target pathogenic behaviors without selecting for resistance, or microbiome-based interventions that leverage understanding of S. epidermidis ecology, may offer alternative translational pathways for clinical impact . Throughout the translational process, researchers should maintain awareness of regulatory considerations and healthcare implementation challenges that will ultimately determine successful clinical application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.