Recombinant Staphylococcus epidermidis UPF0316 protein SERP1448 (SERP1448)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SERP1448; UPF0316 protein SERP1448
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Target Names
SERP1448
Target Protein Sequence
MSAIAQNPWLMVLAIFIINVCYVTFLTMRTILTLKGYRYVAAVVSFMEVLVYVVGLGLVM SSLDQIQNIFAYALGFSVGIIVGMKIEEKLALGYTVVNVTSSEYELDLPNELRNLGYGVT HYEAFGRDGSRMVMQILTPRKYELKLMDTVKNLDPKAFIIAYEPRNIHGGFWVKGVRKRK LKAYEPEQLEVVVDHEEIVGGSSNEQKV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant SERP1448 protein be stored for optimal stability?

For optimal stability of recombinant SERP1448 protein:

  • Store at -20°C for regular use

  • For extended storage periods, maintain at either -20°C or -80°C

  • Avoid repeated freezing and thawing cycles as this significantly reduces protein stability

  • Working aliquots can be safely stored at 4°C for up to one week

  • The recommended storage buffer is Tris-based with 50% glycerol, optimized for this specific protein

What is the biological context of Staphylococcus epidermidis and why study its proteins?

Key points about the biological context:

  • S. epidermidis typically maintains a benign relationship with its human host

  • It lacks aggressive virulence determinants common to dedicated pathogens

  • Factors that normally sustain its commensal lifestyle can contribute to pathogenicity in certain contexts

  • It plays significant roles in balancing the epithelial microflora

  • It can serve as a reservoir for antimicrobial resistance genes

Studying proteins like SERP1448 helps understand the molecular basis of both commensal and infectious lifestyles of this organism, potentially leading to better treatment or prevention strategies for S. epidermidis infections.

What experimental approaches are recommended for initial characterization of SERP1448?

For initial characterization of SERP1448, a systematic approach using multiple complementary techniques is recommended:

  • Sequence analysis and bioinformatics:

    • Conduct homology searches to identify similar proteins with known functions

    • Predict subcellular localization, transmembrane domains, and potential functional motifs

    • Analyze secondary structure predictions

  • Expression analysis:

    • Quantify expression levels under different growth conditions using qRT-PCR

    • Determine if expression changes during biofilm formation or host interaction

  • Basic biochemical characterization:

    • Determine optimal buffer conditions for activity

    • Assess oligomerization state using gel filtration

    • Perform circular dichroism to assess secondary structure content

  • Localization studies:

    • Use fluorescent protein fusions to determine subcellular localization

    • Conduct fractionation studies to confirm membrane association

  • Protein-protein interaction screening:

    • Perform pull-down assays to identify potential binding partners

    • Consider yeast two-hybrid screening for interaction partners

How can experimental design principles be optimized for studying SERP1448 function?

Optimizing experimental design for SERP1448 functional studies requires a structured approach based on scientific examination in controlled environments. The key is to systematically manipulate independent variables while measuring their effects on dependent variables.

Table 1: Experimental Design Framework for SERP1448 Functional Studies

Design ComponentApplication to SERP1448 ResearchMethodological Considerations
Hypothesis formulationDevelop testable statements about SERP1448 functionMust be specific and falsifiable
Variable identificationIndependent: Expression levels, mutations, environmental conditions
Dependent: Phenotypic changes, binding affinities, etc.
Ensure variables can be precisely manipulated and measured
Control selectionWild-type protein, known membrane proteins, empty vectorsInclude positive and negative controls in each experiment
RandomizationRandomize sample processing order and plate positionsMinimizes systematic errors and bias
Replication strategyMinimum three biological replicates with technical triplicatesPower analysis to determine adequate sample size
Statistical approachANOVA for multiple condition comparison; t-tests for pairwise comparisonSelect methods appropriate for data distribution

What methodologies can be employed to assess the role of SERP1448 in S. epidermidis biofilm formation?

Assessing SERP1448's potential role in biofilm formation requires a multi-faceted approach:

  • Gene knockout and complementation studies:

    • Generate SERP1448 deletion mutants using allelic replacement

    • Complement with wild-type and mutant versions to confirm phenotype specificity

    • Quantify biofilm formation using crystal violet staining assays

  • Advanced microscopy techniques:

    • Employ confocal laser scanning microscopy with live/dead staining to assess biofilm architecture

    • Use atomic force microscopy to evaluate cell surface properties

    • Apply super-resolution microscopy to localize SERP1448 within biofilm structures

  • Transcriptomic and proteomic analysis:

    • Compare wild-type and ΔSERP1448 strains during biofilm development

    • Identify differentially expressed genes related to adhesion and extracellular matrix production

    • Measure production of polysaccharide intercellular adhesin (PIA)

  • Flow cell systems:

    • Monitor biofilm development in real-time under controlled flow conditions

    • Assess mechanical properties and resistance to shear stress

S. epidermidis biofilms primarily consist of poly-N-acetylglucosamine (PNAG) homopolymer, also called polysaccharide intercellular adhesin (PIA). This critical component surrounds and connects S. epidermidis cells in a biofilm and has β 1–6 linkages that distinguish it from other natural poly-N-acetylglucosamine polymers. Any impact of SERP1448 on PIA production should be carefully quantified .

How can immunological responses to SERP1448 be assessed in relation to S. epidermidis colonization and infection?

To evaluate immunological responses to SERP1448, implement a comprehensive immunological assessment strategy:

  • Antibody response characterization:

    • Develop ELISAs to measure SERP1448-specific IgG1, IgG4, and IgE antibodies in human sera

    • Compare antibody levels between healthy individuals and those with S. epidermidis infections

    • Calculate antibody ratios (e.g., IgG4/IgG1) to identify potential allergenic properties

  • T-cell response evaluation:

    • Isolate peripheral blood mononuclear cells (PBMCs) from donors

    • Stimulate with purified SERP1448 and measure cytokine production

    • Compare cytokine profiles between healthy individuals and patients with S. epidermidis infections

    • Specifically measure Th1 (IFN-γ), Th2 (IL-4, IL-5, IL-13), Th17 (IL-17, IL-22), and regulatory (IL-10) cytokines

  • In vitro immunomodulation studies:

    • Assess SERP1448 impact on dendritic cell maturation and antigen presentation

    • Evaluate effects on pattern recognition receptor signaling

    • Test for potential proteolytic activity against immune mediators like IL-33

Based on studies of other S. epidermidis proteins, the T-cell response in healthy individuals typically features IL-17, IL-22, IFN-γ, and IL-10 production, whereas responses in individuals with conditions like atopic dermatitis may show decreased IL-17 production and increased Th2 cytokine release .

What techniques are optimal for structural characterization of SERP1448?

For comprehensive structural characterization of SERP1448, employ multiple complementary techniques:

Since SERP1448 is predicted to be a membrane-associated protein based on its sequence, consider including membrane mimetics such as detergent micelles, nanodiscs, or liposomes in structural studies to maintain native conformation .

How can the potential role of SERP1448 in host-pathogen interactions be experimentally investigated?

To investigate SERP1448's potential role in host-pathogen interactions, implement a multi-level experimental strategy:

  • Adhesion and invasion assays:

    • Compare wild-type and ΔSERP1448 mutant strains for adherence to relevant cell types (keratinocytes, endothelial cells)

    • Quantify bacterial invasion using gentamicin protection assays

    • Evaluate binding to extracellular matrix components (fibronectin, fibrinogen, collagen)

  • Host cell response studies:

    • Stimulate host cells with purified SERP1448

    • Measure inflammatory cytokine production (IL-6, IL-8, TNF-α)

    • Assess activation of pattern recognition receptors and downstream signaling pathways

    • Evaluate effects on host cell viability and apoptosis

  • In vivo infection models:

    • Utilize murine skin infection or catheter-associated infection models

    • Compare infection outcomes between wild-type and ΔSERP1448 strains

    • Measure bacterial burden, inflammatory responses, and tissue damage

    • Conduct competitive infection assays to assess fitness contribution

  • Proteomics approaches:

    • Perform pull-down assays with biotinylated SERP1448 using host cell lysates

    • Identify potential host binding partners by mass spectrometry

    • Validate interactions using surface plasmon resonance or microscale thermophoresis

Unlike S. aureus, S. epidermidis lacks aggressive virulence determinants, but factors that support its commensal lifestyle may contribute to pathogenicity in certain contexts. For instance, S. epidermidis produces adhesion proteins like SdrG (Fbe) that promote attachment to host tissues and biomaterials. Investigating whether SERP1448 has similar functions or modulates the activity of such adhesins would be valuable .

What are the critical factors for optimizing recombinant expression of SERP1448?

Optimizing recombinant expression of SERP1448 requires careful consideration of multiple factors:

Table 2: Key Parameters for SERP1448 Recombinant Expression Optimization

ParameterOptions to TestConsiderations
Expression systemE. coli (BL21, Rosetta), Yeast, Insect cellsMembrane proteins often require eukaryotic systems
Expression vectorpET, pGEX, pMAL, pBADEvaluate different promoters and fusion tags
Induction conditionsTemperature (16-37°C), Inducer concentration, DurationLower temperatures often improve folding of membrane proteins
Media compositionLB, TB, Auto-induction, Minimal mediaRich media for high yield; minimal media for labeled protein
Fusion tagsHis, GST, MBP, SUMOMBP and SUMO can enhance solubility
Cell lysis methodSonication, French press, Detergent lysisGentle methods may preserve protein structure
Purification strategyIMAC, Ion exchange, Size exclusionMulti-step purification for highest purity
Buffer optimizationpH (6.0-8.0), Salt (100-500mM), AdditivesMembrane proteins may require detergents or stabilizers

For membrane-associated proteins like SERP1448, consider:

  • Including appropriate detergents (DDM, LDAO, etc.) during extraction and purification

  • Testing membrane mimetics (nanodiscs, liposomes) for functional studies

  • Using an experimental design approach with factorial design to systematically optimize multiple parameters simultaneously

How can researchers troubleshoot common challenges in SERP1448 functional studies?

Table 3: Troubleshooting Guide for SERP1448 Functional Studies

ChallengePossible CausesSolutions
Low protein expressionToxicity to host, poor codon usage, improper foldingTry different host strains, codon optimization, lower induction temperature, fusion partners
Protein aggregationImproper folding, high concentration, unsuitable bufferInclude stabilizing agents, optimize buffer conditions, use solubility-enhancing tags
Loss of function during purificationDenaturation, critical cofactor loss, proteolysisInclude protease inhibitors, maintain mild conditions, supplement with potential cofactors
Inconsistent activity assaysVariable protein quality, unstable reagents, temperature fluctuationsStandardize protein preparation, prepare fresh reagents, control environmental conditions
Non-specific binding in interaction studiesHydrophobic interactions, improper blocking, high concentrationOptimize blocking agents, include competitors, reduce protein concentration
Poor reproducibility in cell-based assaysPassage number variation, contamination, serum lot differencesStandardize cell culture conditions, use low-passage cells, test multiple serum lots

When investigating membrane-associated proteins like SERP1448, specific additional challenges may include:

  • Difficulty maintaining native conformation outside the membrane environment

  • Proper orientation in artificial membrane systems

  • Distinguishing specific interactions from non-specific membrane association

Address these by employing multiple complementary approaches and always including appropriate controls .

How might SERP1448 contribute to S. epidermidis immune evasion strategies?

S. epidermidis has evolved mechanisms to maintain its commensal relationship while avoiding host immune clearance. Future research should investigate whether SERP1448 plays a role in these processes through approaches such as:

  • Evaluating SERP1448's potential interaction with components of innate immunity:

    • Complement factors

    • Antimicrobial peptides

    • Pattern recognition receptors

  • Investigating its possible role in modulating adaptive immune responses:

    • Effects on antigen presentation

    • T-cell activation and differentiation

    • Antibody production and effectiveness

  • Determining if SERP1448 has enzymatic activity that might modify host immune mediators:

    • Proteolytic activity against cytokines or chemokines

    • Modification of host cell surface receptors

    • Alteration of extracellular matrix components

Recent research has shown that some S. epidermidis proteins, like the extracellular serine protease (Esp), can cleave and activate the alarmin IL-33, potentially modulating type 2 immune responses. Comparing SERP1448's structure and function with known immunomodulatory proteins from staphylococcal species could provide valuable insights .

What potential applications could emerge from thorough characterization of SERP1448?

Comprehensive characterization of SERP1448 could lead to several valuable applications:

  • Diagnostic developments:

    • SERP1448-specific antibodies could serve as biomarkers for S. epidermidis colonization or infection

    • Distinguishing commensal from pathogenic states based on SERP1448 expression patterns

    • Development of rapid diagnostic tests targeting SERP1448

  • Therapeutic targets:

    • If SERP1448 proves essential for colonization or virulence, it could become a target for anti-infective agents

    • Design of inhibitors that specifically disrupt SERP1448 function without affecting commensal bacteria

    • Development of antibody-based therapies targeting SERP1448 in pathogenic contexts

  • Biotechnological applications:

    • Exploitation of any unique enzymatic activities for biotechnology applications

    • Use in protein engineering as a scaffold for novel functions

    • Application in synthetic biology systems

  • Fundamental understanding:

    • Better comprehension of host-microbe interactions in health and disease

    • Insights into mechanisms of bacterial adaptation to commensal versus pathogenic lifestyles

    • Enhanced knowledge of bacterial membrane protein structure and function

The deep characterization of SERP1448 would contribute to our understanding of the molecular basis of S. epidermidis as both a commensal organism and an "accidental" pathogen .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.