Recombinant Staphylococcus epidermidis UPF0365 protein SE_1260 (SE_1260)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; SE_1260; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Staphylococcus epidermidis (strain ATCC 12228)
Target Names
SE_1260
Target Protein Sequence
MFSIGFIIIAVIIVVALLILFSFVPVGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLNLTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERGAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSEHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVASEQEMKARVQEMRAKVVEAESEVPLAMAEALRSGNIGVKDYY NLKNIEADTGMRNAINKRTDQNDDESPQQ
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.

Database Links

KEGG: sep:SE1260

STRING: 176280.SE1260

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What experimental approaches are recommended for initial functional characterization of SE_1260?

For initial functional characterization, researchers should employ multiple complementary approaches:

  • Bioinformatic analysis: Utilize tools like InterPro, Pfam, and BLAST to identify conserved domains and potential functional homologs

  • Subcellular localization: Use fluorescent fusion proteins (GFP-SE_1260) to determine cellular localization

  • Gene knockout/knockdown: Create deletion mutants in S. epidermidis and assess phenotypic changes in:

    • Biofilm formation capacity using crystal violet assays

    • Growth curves under various stress conditions

    • Cell wall integrity tests

  • Protein-protein interaction screens: Employ bacterial two-hybrid or pull-down assays to identify potential binding partners

Since UPF0365 designates an uncharacterized protein family, these approaches may provide initial insights into function while avoiding assumptions based solely on sequence similarity.

What expression systems and conditions optimize recombinant SE_1260 production?

While commercial preparations exist, researchers developing their own expression systems should consider:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, cost-effectivePotential membrane protein folding issues
S. aureus expressionNative-like post-translational modificationsLower yield, more challenging genetic manipulation
Cell-free systemAvoids toxicity issuesHigher cost, potentially lower yield

Optimization protocol:

  • Test multiple fusion tags (His6, GST, MBP) positioned at either N-terminus or C-terminus

  • For E. coli expression, optimize induction conditions:

    • IPTG concentration (0.1-1.0 mM)

    • Temperature (16°C, 25°C, 37°C)

    • Duration (4h vs. overnight)

  • Include membrane solubilization buffers during extraction if the hydrophobic regions cause aggregation

What storage conditions maximize stability for functional studies of purified SE_1260?

The optimal storage conditions for maintaining SE_1260 stability include:

  • Storage buffer: Tris-based buffer with 50% glycerol (optimized specifically for this protein)

  • Temperature: Store at -20°C; for extended storage, use -80°C

  • Handling: Avoid repeated freeze-thaw cycles; prepare single-use aliquots

  • Working storage: Aliquots can be stored at 4°C for up to one week without significant degradation

For stability studies, researchers should employ differential scanning fluorimetry to optimize buffer conditions by screening:

  • pH range (6.0-8.5)

  • Salt concentrations (0-500 mM NaCl)

  • Glycerol percentages (0-50%)

  • Stabilizing additives (trehalose, arginine, detergents for membrane proteins)

How might SE_1260 contribute to S. epidermidis biofilm formation?

While direct evidence linking SE_1260 to biofilm formation is lacking, methodological approaches to investigate this potential relationship include:

  • Comparative analysis with known biofilm proteins: Compare structural features of SE_1260 with characterized S. epidermidis biofilm proteins like Aap (accumulation-associated protein) and SdrF (Serine-aspartate repeat protein F)

  • Biofilm inhibition assays: Test if:

    • Antibodies against SE_1260 inhibit biofilm formation

    • Recombinant SE_1260 competes with native protein in biofilm assays

  • Localization studies in biofilms: Use immunogold labeling with anti-SE_1260 antibodies to determine if the protein localizes within biofilm matrix structures, particularly in relation to known amyloid-forming proteins like Aap and Sbp (small basic protein)

  • Protein-protein interaction studies: Investigate potential interactions with:

    • Aap G5-E repeats involved in zinc-dependent homophilic interactions

    • Sbp protein, which contributes to biofilm matrix integrity

    • Extracellular DNA components of biofilms

The hydrophobic N-terminal region of SE_1260 suggests potential membrane association, which could be relevant to the initial attachment phase of biofilm formation .

What experimental designs can determine if SE_1260 influences S. epidermidis virulence in medical device infections?

To investigate the role of SE_1260 in device-related infections:

  • Genetic manipulation:

    • Create isogenic SE_1260 knockout mutants

    • Develop complemented strains to confirm phenotype specificity

    • Engineer strains with controlled expression levels

  • In vitro device models:

    • Compare wild-type and mutant adherence to biomaterials using:

      • Flow cell chambers with implant materials

      • Confocal microscopy quantification of attachment

      • Scanning electron microscopy for detailed structural analysis

  • Transcriptomic analysis:

    • Compare gene expression in:

      • Planktonic vs. biofilm growth conditions

      • Regular culture vs. conditions mimicking implant surfaces

      • Wild-type vs. SE_1260 mutant strains

  • Animal infection models:

    • Catheter infection model (comparing wild-type vs. mutant strains)

    • Quantify bacterial load, biofilm formation, and host response

These approaches would help determine if SE_1260 belongs among the virulence factors associated with poor outcomes in S. epidermidis device-related infections, similar to factors identified in comparative genomics studies .

What specialized techniques are needed to determine the structure of SE_1260?

For structural characterization of SE_1260, especially considering its potential membrane association:

Since UPF0365 is an uncharacterized protein family, structural information would provide valuable insights into potential function.

How can researchers determine if SE_1260 undergoes post-translational modifications important for function?

To characterize potential post-translational modifications (PTMs):

  • Mass spectrometry approaches:

    • Bottom-up proteomics: Tryptic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein mass

    • Targeted methodologies for specific modifications:

      • Phosphorylation: TiO₂ enrichment

      • Glycosylation: Lectin affinity enrichment

      • Lipidation: Click chemistry labeling

  • Site-directed mutagenesis:

    • Systematically mutate potential PTM sites

    • Assess functional consequences through:

      • Localization studies

      • Protein-protein interaction assays

      • Activity measurements

  • Comparative analysis:

    • Examine PTM patterns in SE_1260 expressed in:

      • Native S. epidermidis

      • Heterologous expression systems

      • Different growth conditions

PTMs could be particularly relevant if SE_1260 functions in host-pathogen interactions, as seen with other S. epidermidis surface proteins .

What methodologies can determine if SE_1260 interacts with host immune components?

To investigate potential immunological roles of SE_1260:

  • Host cell binding assays:

    • Flow cytometry with fluorescently-labeled SE_1260

    • Cell types to test:

      • Keratinocytes (relevant to skin colonization)

      • Macrophages and neutrophils (innate immune cells)

      • Dendritic cells (antigen presentation)

  • Cytokine response measurements:

    • Stimulate immune cells with purified SE_1260

    • Measure cytokine profiles via:

      • ELISA for key cytokines (IL-1β, IL-6, TNF-α, IL-10)

      • Multiplex cytokine arrays

      • qPCR for cytokine gene expression

  • T-cell activation assays:

    • Similar to studies conducted with S. epidermidis Esp (extracellular serine protease)

    • Measure T-cell subtype differentiation (Th1, Th2, Th17)

    • Compare responses between healthy donors and patients with skin conditions

  • Antibody recognition studies:

    • Screen patient sera for antibodies against SE_1260

    • Compare antibody levels between:

      • Healthy individuals

      • Patients with S. epidermidis infections

      • Individuals with atopic dermatitis (where S. epidermidis proteins can act as allergens)

How can researchers determine if SE_1260 contributes to immune evasion or colonization?

To investigate the protein's role in immune evasion or colonization:

  • Colonization models:

    • Skin explant models comparing wild-type and SE_1260 knockout strains

    • Competitive colonization assays

    • Long-term persistence measurements

  • Immune evasion assays:

    • Complement activation/inhibition

    • Neutrophil killing assays

    • Antimicrobial peptide resistance testing

  • Transcriptomic approaches:

    • RNA-seq of host cells exposed to wild-type vs. SE_1260 mutant

    • Pathway analysis to identify affected immune signaling networks

    • Validation of key genes through qPCR and protein expression

  • In vivo approaches:

    • Murine skin colonization models

    • Humanized mouse models

    • Gnotobiotic models with controlled microbiome

These methodologies would help place SE_1260 in context with other S. epidermidis factors that modulate host immune responses, particularly in the skin microenvironment .

How conserved is SE_1260 across S. epidermidis strains, and what does this suggest about its function?

To investigate conservation and evolutionary significance:

  • Sequence analysis pipeline:

    • Extract SE_1260 homologs from genomic databases

    • Perform multiple sequence alignment

    • Calculate conservation scores for each residue

    • Identify highly conserved domains as functionally important

  • Comparative genomics approaches:

    • Analyze synteny (gene neighborhood conservation)

    • Examine association with mobile genetic elements

    • Compare presence/absence between:

      • Commensal vs. pathogenic strains

      • Antibiotic resistant vs. susceptible isolates

      • Biofilm-forming vs. non-biofilm-forming isolates

  • Phylogenetic analysis:

    • Construct gene trees for SE_1260

    • Compare with species phylogeny to identify horizontal gene transfer

    • Analyze selective pressure (dN/dS ratio) to identify regions under positive selection

  • Population genomics:

    • Screen clinical isolate collections for SE_1260 variants

    • Associate variants with clinical outcomes similar to comparative genomics approaches used in orthopedic device-related infections

What experimental approaches can elucidate the relationship between SE_1260 and homologs in other staphylococcal species?

To investigate cross-species relationships:

  • Functional complementation:

    • Express SE_1260 homologs from other species in S. epidermidis SE_1260 knockout

    • Test restoration of phenotypes:

      • Growth characteristics

      • Biofilm formation

      • Virulence properties

  • Chimeric protein analysis:

    • Create fusion proteins between domains from different species

    • Map functional domains through domain swapping

    • Identify species-specific adaptations

  • Co-evolution analysis:

    • Identify proteins that co-evolve with SE_1260

    • Test for physical interactions between co-evolving proteins

    • Construct functional networks based on evolutionary signatures

  • Heterologous expression studies:

    • Express SE_1260 in:

      • S. aureus (pathogenic relative)

      • Non-staphylococcal Gram-positive bacteria

      • Assess phenotypic changes and protein localization

These approaches would provide evolutionary context for SE_1260 and could identify conserved functions across the Staphylococcus genus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.