Recombinant Staphylococcus epidermidis UPF0365 protein SERP1140 (SERP1140)

What is SERP1140 and what is its significance in S. epidermidis biology?

SERP1140 is a UPF0365 family protein found in Staphylococcus epidermidis strain ATCC 35984 / RP62A. It is characterized by a 329 amino acid sequence with a molecular weight of approximately 50 μg per standard preparation . The protein contains a transmembrane domain with characteristic hydrophobic regions that suggest integration into the bacterial membrane. While its precise biological function remains under investigation, structural analysis indicates it may play a role in bacterial membrane integrity or cellular transport mechanisms. Unlike more extensively studied S. epidermidis proteins such as SdrG (a fibrinogen-binding protein) or Aap (accumulation-associated protein), SERP1140's specific contribution to bacterial physiology is still being elucidated .

How does SERP1140 compare structurally to other characterized S. epidermidis proteins?

SERP1140 differs significantly from better-characterized S. epidermidis surface proteins like SdrG and Aap. While SdrG is a surface-associated fibrinogen binding protein that increases expression during bloodstream infection , and Aap contains a parallel β-helix domain that influences intercellular adhesion , SERP1140 belongs to the UPF0365 protein family with distinct structural characteristics.

Its amino acid sequence reveals a membrane-spanning protein with the sequence: "MFSIGFIIIAVIIVVALLILFSFVPVGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAPLIKAHKAGLNLTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERGAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVSSTIGSSEHHTEVLENPDNISKTYLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALADKNIAQAKAEERRAMAVASEQEMKARVQEMRAKVVEAESEVPLAMAEALRSGNIGVKDYYNLKNIEADTGMRNAINKRTDQNDDESPQQ" . Unlike SdrG, which has distinct N-terminal domains (N1N2N3) that are crucial for its function and immunogenicity , SERP1140's domain organization appears less complex but contains regions that suggest potential functional significance in membrane processes.

What expression systems are most effective for recombinant SERP1140 production?

For optimal expression of recombinant SERP1140, E. coli-based expression systems typically provide sufficient yields for research purposes. Based on approaches used with similar S. epidermidis proteins, BL21(DE3) strains with pET vector systems offer a reliable platform for expression . The protein can be expressed with various tags (His, GST, or MBP) to facilitate purification, though the specific tag should be selected based on the intended experimental application .

When expressing transmembrane proteins like SERP1140, it's critical to optimize induction conditions to prevent formation of inclusion bodies. Recommended parameters include:

• IPTG concentration: 0.1-0.5 mM

• Induction temperature: 16-25°C

• Induction duration: 12-18 hours

• OD600 at induction: 0.6-0.8

For applications requiring native protein conformation, mammalian or insect cell expression systems may be preferable, especially when studying interactions with host proteins or for structural analysis requiring proper folding .

What experimental approaches are most effective for studying SERP1140's function in S. epidermidis?

To elucidate SERP1140's function, a multi-faceted experimental approach is recommended. Single-subject experimental designs (SSEDs) can be particularly valuable for establishing causal relationships between SERP1140 expression and phenotypic outcomes . Consider implementing the following methodological framework:

• Gene knockout studies: Create a SERP1140 deletion mutant in S. epidermidis using allelic replacement techniques. Compare growth kinetics, membrane integrity, and stress responses between wild-type and mutant strains under various environmental conditions.

• Complementation analysis: Reintroduce SERP1140 into the deletion mutant under both native and inducible promoters to confirm phenotypic restoration, which validates gene function.

• Protein localization: Employ immunofluorescence microscopy similar to techniques used for SdrG localization to determine SERP1140's distribution within the cell.

• Interactome analysis: Identify protein interaction partners using pull-down assays with recombinant tagged SERP1140, followed by mass spectrometry to identify binding partners.

• Transcriptional regulation studies: Analyze SERP1140 expression under various environmental conditions, similar to the approach used for SdrG , to identify potential regulators and expression cues.

When designing these experiments, robust controls are essential. Include isogenic strains expressing irrelevant proteins of similar size and localization to distinguish specific from non-specific effects .

How can I differentiate between the native and recombinant forms of SERP1140 in experimental analyses?

Distinguishing between native and recombinant SERP1140 requires strategic experimental design and analytical techniques. For immunodetection methods, develop antibodies against both the whole protein and specific epitopes that may be altered or masked in the recombinant form. When using recombinant SERP1140 with fusion tags, design primers for quantitative PCR that specifically amplify either the fusion region (recombinant only) or regions common to both forms .

For proteomic analyses, consider the following approaches:

• Mass spectrometry can identify post-translational modifications present in the native but not recombinant form

• Size-exclusion chromatography can differentiate between different oligomeric states

• Limited proteolysis patterns often differ between native and recombinant proteins due to subtle conformational differences

When conducting functional assays, include controls using heat-inactivated recombinant protein to distinguish between specific biological activity and non-specific effects. If studying membrane association, use differential centrifugation and membrane fractionation to compare subcellular localization patterns .

What methodological approaches can resolve conflicting data regarding SERP1140's role in S. epidermidis virulence?

When faced with conflicting data regarding SERP1140's role in virulence, employ a systematic approach to resolve discrepancies:

• Strain variation analysis: S. epidermidis is genetically diverse, and protein function may vary across strains. Sequence SERP1140 across multiple clinical and commensal isolates to identify polymorphisms that might explain functional differences .

• Context-dependent expression studies: Similar to SdrG, which shows increased expression specifically in bloodstream conditions , SERP1140 may have context-dependent roles. Use quantitative transcriptomics and proteomics across multiple infection models (biofilm, bloodstream, indwelling device) to determine if expression patterns explain conflicting results.

• Host factor interaction analysis: Examine whether SERP1140 interacts with different host factors in different experimental systems. Engineering approaches similar to those used for Aap-based constructs can help identify specific interaction domains.

• Immunological relevance assessment: Determine whether SERP1140 elicits an antibody response during colonization or infection, similar to analyses performed for other S. epidermidis proteins . This can clarify its in vivo accessibility and immunological significance.

• Combined in vitro and in vivo approaches: Integrate findings from multiple experimental systems using meta-analysis techniques to identify variables that consistently influence SERP1140's apparent function.

When evaluating conflicting literature, create a comprehensive data table documenting experimental conditions, strain backgrounds, and methodological differences to identify patterns that explain discrepancies .

What structural features of SERP1140 are critical for its predicted membrane localization?

SERP1140's membrane localization is primarily determined by its N-terminal hydrophobic regions. Analysis of the amino acid sequence reveals a characteristic pattern of hydrophobic residues (MFSIGFIIIAVIIVVALLILFSFVPVGLWISALAAGVHVGIGT) at the N-terminus that forms a transmembrane domain . This region likely anchors the protein in the bacterial membrane, with the more hydrophilic C-terminal portion extending into either the cytoplasm or extracellular space.

Unlike SdrG, which attaches to the cell wall via a LPXTG motif and sortase-mediated anchoring , or recombinant fusion proteins that can be attached using SpyCatcher/SpyTag systems , SERP1140 likely integrates directly into the membrane bilayer. Computational topology prediction suggests the protein has:

• 1-2 transmembrane domains

• A cytoplasmic N-terminal region

• A larger C-terminal domain that may be exposed externally

For experimental verification of these predictions, consider using:

• Protease accessibility assays with intact cells

• Selective biotinylation of surface-exposed regions

• GFP fusion constructs positioned at different termini to assess orientation

How can I design SERP1140 truncation constructs to identify functional domains?

Designing effective truncation constructs for SERP1140 requires careful consideration of its predicted domain structure and potential functional regions. Based on sequence analysis and comparison with related proteins, consider the following truncation strategy:

• N-terminal transmembrane domain (aa 1-40): This region likely mediates membrane insertion and should be removed for soluble expression constructs but maintained for studies of membrane association.

• Middle domain (aa 41-200): This region contains conserved sequences that may mediate protein-protein interactions or enzymatic activity.

• C-terminal domain (aa 201-329): Often involved in substrate recognition or regulatory functions.

Create systematic truncations that preserve predicted secondary structure elements rather than arbitrary segments. For each construct, consider:

• Adding a flexible linker (GGGGS)n between the tag and protein fragment

• Including both N- and C-terminal tagged versions of each construct

• Using a consistent expression system for comparative analysis

When expressing these constructs, evaluate them for:

• Solubility and stability

• Proper folding (using circular dichroism)

• Retained functional activities

• Interaction with known binding partners

Similar approaches were successfully used with other S. epidermidis proteins, such as the N1N2N3 and N2N3 subdomains of SdrG , which maintained immunogenicity but showed different functional properties.

What experimental methods best characterize SERP1140 interactions with host proteins?

To comprehensively characterize SERP1140 interactions with host proteins, employ a multi-method approach:

• Initial screening methods:

  • Pull-down assays using recombinant tagged SERP1140 with host cell lysates

  • Protein microarrays with purified SERP1140 probed against common host proteins

  • Yeast two-hybrid screening against human cDNA libraries

• Validation and characterization methods:

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • ELISA-based binding assays for quantitative analysis

  • Microscale thermophoresis for interaction studies in complex solutions

• Functional validation:

  • Co-immunoprecipitation from infected host cells

  • Fluorescence resonance energy transfer (FRET) for in situ interaction validation

  • Mutational analysis of predicted interaction interfaces

  • Competition assays with peptides derived from interaction regions

• In vivo relevance:

  • Infection models comparing wild-type and SERP1140-deficient strains

  • Antibody blocking studies targeting specific interaction domains

  • siRNA knockdown of candidate host targets

These methodologies should be applied within a systematic framework similar to approaches used for characterizing Aap interactions , with appropriate controls to distinguish specific from non-specific binding events.

What are the optimal buffer conditions for maintaining SERP1140 stability during purification?

Maintaining SERP1140 stability during purification requires careful buffer optimization. Based on the protein's characteristics and stability requirements for similar bacterial membrane proteins, the following buffer system is recommended:

Base buffer composition:

• 50 mM Tris-HCl or phosphate buffer (pH 7.4-8.0)

• 150-300 mM NaCl (to maintain ionic strength)

• 10% glycerol (as a stabilizing agent)

• 1 mM DTT or 5 mM β-mercaptoethanol (to prevent oxidation of cysteine residues)

Critical considerations:

• pH stability range: SERP1140 shows optimal stability between pH 7.0-8.0, with reduced stability at acidic pH.

• Salt concentration: Titrate NaCl between 150-500 mM to determine optimal ionic strength.

• Detergent selection: For membrane-associated forms, include mild detergents:

  • 0.05-0.1% n-Dodecyl β-D-maltoside (DDM)

  • 0.5-1% CHAPS

  • 0.5% Triton X-100 (for initial extraction only)

• Stabilizing additives: Consider including:

  • 5-10% glycerol

  • 1-5 mM EDTA (to chelate metal ions that might promote degradation)

  • Protease inhibitor cocktail

During storage, maintain the purified protein at -80°C in buffer containing 50% glycerol . For experiments requiring removal of the fusion tag, optimize protease cleavage conditions to maintain stability of the native protein.

How can I design a single-subject experimental protocol to assess SERP1140 immunogenicity?

To assess SERP1140 immunogenicity using a single-subject experimental design (SSED) protocol, adapt established approaches that have been successful with other S. epidermidis proteins . The following experimental design integrates SSED principles with immunological assessment:

Experimental design:

• Multiple baseline design with staggered introduction of SERP1140 immunization across subjects

• ABAB design to evaluate antibody response persistence and boosting effects

• Changing criterion design to assess dose-dependent responses

Protocol framework:

• Subject selection: Use inbred mouse strain (e.g., C57BL/6) to minimize genetic variability

• Baseline measurements:

  • Collect pre-immunization serum at multiple timepoints (days -21, -14, -7)

  • Analyze baseline antibody levels using ELISA against SERP1140

  • Assess cross-reactivity with other S. epidermidis proteins

• Intervention phase:

  • Primary immunization with recombinant SERP1140 (50 μg per mouse)

  • Staggered immunization schedule across subjects

  • Collect serum samples at regular intervals (days 7, 14, 21, 28)

• Withdrawal phase:

  • Monitor antibody decline over 30-60 days post-immunization

  • Analyze antibody classes (IgG, IgM, IgA) and subclasses

• Reintroduction phase:

  • Boost with SERP1140 immunization

  • Compare primary and secondary response kinetics

• Data analysis:

  • Visual analysis of antibody titer trends

  • Statistical process control charts to detect significant changes

  • Percentage of non-overlapping data points analysis

  • Tau-U analysis for trend and level changes

This design allows for rigorous evaluation of causality between SERP1140 exposure and antibody response, similar to approaches used for SdrG immunogenicity assessment , while controlling for individual variability and temporal factors .

What strategic approaches can resolve expression challenges for full-length SERP1140?

Expressing full-length SERP1140 presents challenges due to its transmembrane domains and potential toxicity to host cells. To overcome these obstacles, implement the following strategic approaches:

These approaches have been successfully applied to other challenging membrane proteins from S. epidermidis and can be adapted for SERP1140 .

How can SERP1140 be utilized in vaccine development approaches against S. epidermidis?

SERP1140's potential as a vaccine component against S. epidermidis should be evaluated systematically, drawing on successful approaches used with other S. epidermidis proteins like SdrG . Consider the following strategic framework:

• Expression profiling during infection:

  • Determine if SERP1140 expression increases during colonization or infection, similar to SdrG's upregulation in bloodstream conditions

  • Verify surface accessibility using antibody binding to intact bacteria

  • Assess conservation across clinical isolates to ensure broad coverage

• Immunogenicity assessment:

  • Evaluate antibody response to SERP1140 in humans with S. epidermidis infections

  • Compare SERP1140-specific antibody levels in colonized vs. non-colonized individuals

  • Determine if antibodies against SERP1140 correlate with protection from infection

• Epitope mapping and optimization:

  • Identify immunodominant epitopes using peptide arrays

  • Create constructs focusing on exposed and conserved regions

  • Consider domain-specific constructs similar to the N2N3 subdomain approach used for SdrG

• Adjuvant and delivery system optimization:

  • Test multiple adjuvant formulations to enhance immunogenicity

  • Evaluate different administration routes (subcutaneous, intranasal, etc.)

  • Consider conjugation to carrier proteins to increase immunogenicity

• Protection assessment:

  • Challenge models to evaluate vaccine efficacy:

    • Bacteremia models

    • Foreign body infection models

    • Catheter-associated biofilm models

  • Quantify bacterial burdens in vaccinated vs. control animals

  • Measure opsonophagocytic killing by SERP1140-specific antibodies

• Combination approaches:

  • Evaluate SERP1140 in combination with other S. epidermidis antigens

  • Consider chimeric constructs similar to the Aap-TTFC approach

  • Test prime-boost strategies with different constructs

This approach builds on the successful SdrG vaccine development model, where immunization with specific subdomains provided significant protection against experimental infection .

What experimental design best evaluates SERP1140's role in biofilm formation?

To rigorously evaluate SERP1140's potential role in biofilm formation, implement a comprehensive experimental design that incorporates both genetic and biochemical approaches:

• Genetic manipulation studies:

  • Create clean deletion mutants (ΔSERP1140) using allelic replacement

  • Generate complemented strains with SERP1140 under native and inducible promoters

  • Develop point mutants targeting specific domains to identify functional regions

• Static biofilm assays:

  • Crystal violet staining for biomass quantification

  • Confocal microscopy with fluorescent strains to assess architecture

  • Scanning electron microscopy for detailed structural analysis

  • Compare wild-type, mutant, and complemented strains under multiple conditions:

    • Varying media compositions (TSB, BHI, human serum)

    • Different surfaces (polystyrene, glass, implant materials)

    • Presence of host matrix proteins (fibrinogen, fibronectin)

• Dynamic biofilm models:

  • Flow cell systems to evaluate biofilm formation under shear stress

  • Microfluidic devices for real-time observation of biofilm dynamics

  • Drip flow reactors to mimic clinically relevant conditions

• Biochemical interaction studies:

  • Assess SERP1140 binding to biofilm matrix components

  • Evaluate protein-protein interactions with other S. epidermidis surface proteins

  • Test for enzymatic activities that might modify matrix components

• In vivo relevance:

  • Catheter infection models comparing wild-type and ΔSERP1140 strains

  • Explant analysis using immunohistochemistry to localize SERP1140

  • Competition assays between wild-type and mutant strains

• Statistical analysis:

  • ANOVA with post-hoc tests for multiple condition comparisons

  • Repeated measures designs for time-course experiments

  • Effect size calculations to quantify biological significance

This experimental framework integrates elements of single-subject experimental design with population-level analyses to provide robust evidence of SERP1140's role in biofilm processes.

How can researchers design chimeric SERP1140 constructs for immunogen delivery systems?

Designing chimeric SERP1140 constructs for immunogen delivery requires strategic fusion of target antigens while preserving structural integrity and folding. Drawing from successful approaches with other S. epidermidis proteins , implement the following design principles:

• Target antigen selection:

  • Choose antigens with established immunogenicity (e.g., tetanus toxin fragment C)

  • Consider size constraints (ideally <60% of SERP1140's size)

  • Evaluate structural compatibility with SERP1140

• Fusion site identification:

  • Analyze SERP1140 structure for surface-exposed loops or termini

  • Avoid disrupting transmembrane domains or conserved functional regions

  • Consider multiple insertion sites for comparative testing:

    • N-terminal fusion (preserving signal sequence)

    • C-terminal fusion

    • Internal domain replacements

    • Loop insertions

• Linker design:

  • Incorporate flexible linkers (GGGGS)n between SERP1140 and target antigen

  • Test rigid linkers (EAAAK)n when spatial separation is required

  • Consider cleavable linkers if independent function is desired

• Expression vector optimization:

  • Design constructs with multiple tags for purification and detection

  • Include ribosome binding site modifications to optimize expression

  • Consider dual promoter systems for differential expression of fusion partners

• Validation strategy:

  • Verify surface display using immunofluorescence microscopy

  • Confirm antigen conformation using conformation-specific antibodies

  • Assess immunogenicity through antibody response evaluation

• Advanced engineering approaches:

  • SpyCatcher/SpyTag system for modular antigen attachment

  • Self-assembling protein nanoparticles for multivalent display

  • Sortase-mediated transpeptidation for site-specific conjugation

This approach builds on successful engineering strategies demonstrated with Aap-TTFC chimeras, which effectively elicited antibody responses against the target antigen , adapted for the specific structural constraints of SERP1140.

What research gaps currently exist in our understanding of SERP1140 function?

Despite advances in S. epidermidis protein characterization, significant research gaps remain in our understanding of SERP1140. These knowledge deficits represent important opportunities for future investigation:

• Fundamental functional characterization:

  • The precise biological function of SERP1140 remains uncharacterized, unlike better-studied proteins such as SdrG and Aap

  • Structure-function relationships have not been established through crystallographic or NMR studies

  • Potential enzymatic activities suggested by sequence homology remain untested

• Regulation and expression patterns:

  • Unlike SdrG, whose expression increases during bloodstream infection , SERP1140's expression patterns under different conditions remain undefined

  • Transcriptional regulation mechanisms have not been characterized

  • Post-translational modifications that might affect function are unexplored

• Host interactions:

  • Potential interactions with host proteins or immune components are uncharacterized

  • Contribution to immune evasion or colonization has not been assessed

  • Possible role in host-microbe signaling remains an open question

• Clinical relevance:

  • Association with virulence or specific infection types is not established

  • Potential as a biomarker for S. epidermidis infections has not been evaluated

  • Strain-to-strain variation in sequence and expression is poorly documented

• Technological applications:

  • Utility as a vaccine component or therapeutic target requires investigation

  • Potential as a protein engineering scaffold similar to Aap has not been explored

  • Diagnostic applications remain theoretical

Addressing these gaps will require interdisciplinary approaches combining structural biology, molecular microbiology, immunology, and clinical research methodologies.

What methodological innovations could advance SERP1140 research in the next five years?

Several emerging methodological innovations hold promise for advancing SERP1140 research in the coming years:

• Structural biology advances:

  • Cryo-electron microscopy for membrane protein structures without crystallization

  • AlphaFold and related AI prediction tools for structure modeling

  • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

  • Single-molecule FRET for real-time conformational studies

• Genetic engineering approaches:

  • CRISPR-Cas9 base editing for precise genomic modifications in S. epidermidis

  • Inducible CRISPRi systems for temporal control of gene expression

  • Advanced recombineering techniques for scarless genome editing

  • Synthetic genomics approaches for wholesale redesign of protein-coding sequences

• Single-cell technologies:

  • Single-cell RNA-seq to identify heterogeneous expression patterns in bacterial populations

  • Mass cytometry for high-dimensional phenotyping of bacterial cells

  • Advanced microscopy techniques for protein localization at nanoscale resolution

  • Microfluidic systems for tracking single-cell protein expression dynamics

• Host-pathogen interaction analysis:

  • Organoid models for studying S. epidermidis interactions with structured tissues

  • CRISPR screens in host cells to identify interaction partners

  • Metaproteomic approaches to study SERP1140 in complex microbial communities

  • Advanced animal models with humanized immune systems

• Computational approaches:

  • Machine learning for predicting functional partners and networks

  • Molecular dynamics simulations for interaction studies

  • Systems biology models integrating multi-omics data

  • Network analysis tools for placing SERP1140 in biological context

These methodological innovations will enable researchers to address current knowledge gaps and develop a comprehensive understanding of SERP1140's biological functions and potential applications .

How can integrative data analysis approaches resolve contradictions in SERP1140 functional studies?

Resolving contradictions in SERP1140 functional studies requires sophisticated integrative data analysis approaches that synthesize evidence across multiple experimental systems:

• Meta-analysis frameworks:

  • Systematic review of existing literature with standardized quality assessment

  • Quantitative meta-analysis of effect sizes across studies

  • Subgroup analyses to identify variables that explain heterogeneous results

  • Publication bias assessment to identify reporting distortions

• Multi-omics data integration:

  • Correlation of transcriptomic, proteomic, and metabolomic datasets

  • Network analysis to place SERP1140 in biological pathways

  • Integrative clustering to identify conditions with consistent effects

  • Bayesian approaches for causal inference from multiple data types

• Experimental design harmonization:

  • Develop standardized protocols for key SERP1140 experiments

  • Create reference datasets using consistent methodologies

  • Implement inter-laboratory validation studies

  • Establish minimal reporting standards for experimental conditions

• Computational modeling:

  • Develop predictive models of SERP1140 function incorporating multiple datasets

  • Use ensemble methods to improve prediction robustness

  • Sensitivity analysis to identify key variables affecting outcomes

  • Dynamical systems modeling to understand temporal aspects of function

• Advanced statistical approaches:

  • Mixed-effects models to account for heterogeneity across studies

  • Structural equation modeling to test complex causal hypotheses

  • Machine learning for pattern recognition across datasets

  • Bayesian hierarchical modeling to integrate multiple levels of evidence