Recombinant Staphylococcus haemolyticus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus haemolyticus 4,4'-Diaponeurosporenoate Glycosyltransferase (crtQ)

Recombinant Staphylococcus haemolyticus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ) is an engineered enzyme derived from the crtQ gene of Staphylococcus haemolyticus. This glycosyltransferase belongs to the hexosyltransferase family (EC 2.4.1.-) and plays a critical role in the biosynthesis of staphyloxanthin, a carotenoid pigment produced by staphylococci. Staphyloxanthin protects bacterial cells from oxidative stress and contributes to pathogenicity in certain species, though its specific role in S. haemolyticus remains under investigation .

Protein Structure

The recombinant crtQ protein is a full-length (1–375 amino acids) glycosyltransferase expressed in Escherichia coli with an N-terminal His-tag for purification . Its amino acid sequence includes conserved domains associated with glycosylation activity, including residues critical for substrate binding and catalysis .

PropertyValue
UniProt IDQ4L977
Molecular Weight~42 kDa (estimated)
Expression HostE. coli
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (avoid freeze-thaw cycles)

Biochemical Function

crtQ catalyzes the esterification of glucose at the C1'' position of 4,4'-diaponeurosporenoate, forming glycosyl-4,4'-diaponeurosporenoate. This step is essential for the synthesis of staphyloxanthin, which is linked to bacterial survival under oxidative stress . While staphyloxanthin is a hallmark of S. aureus, its presence in S. haemolyticus has not been extensively studied, though crtQ homologs suggest conserved biosynthetic pathways .

Recombinant Production and Purification

The His-tagged crtQ protein is produced via heterologous expression in E. coli, enabling scalable production for biochemical studies. Key parameters include:

ParameterDetail
Expression SystemE. coli BL21(DE3) or similar strains
Induction AgentIsopropyl β-D-1-thiogalactopyranoside (IPTG)
Purification MethodNi-NTA affinity chromatography (His-tag binding)
Yield~2–5 mg/L (typical for bacterial expression systems)

Notes: Post-purification steps may include size-exclusion chromatography to ensure monodispersity .

Functional Assays

Activity assays for crtQ typically involve:

  1. Substrate Preparation: 4,4'-Diaponeurosporenoate and UDP-glucose as donor/acceptor.

  2. Reaction Conditions: pH 7.5–8.0, 25–37°C, Mg²⁺ or Mn²⁺ cofactors.

  3. Detection: HPLC or mass spectrometry to confirm glycosylated product formation .

Comparative Analysis with Other Staphylococcal Glycosyltransferases

FeaturecrtQ (S. haemolyticus)crtQ (S. aureus)
UniProt IDQ4L977Q2FV58
Expression SystemE. coliE. coli
TagHis-tagNative (no tag reported)
Sequence Identity65–70% (estimated)100%
Reported ActivityStructural confirmation onlyFunctional assays validated

Source: Sequence alignment and product specifications .

Challenges and Future Directions

  • Functional Validation: Direct evidence of staphyloxanthin production in S. haemolyticus remains limited.

  • Pathogenicity Link: No studies have linked crtQ activity to S. haemolyticus virulence, unlike in S. aureus.

  • Industrial Applications: Potential use in synthesizing carotenoid derivatives for food/medical industries.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. We recommend consulting your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
crtQ; SH0489; 4,4'-diaponeurosporenoate glycosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
crtQ
Target Protein Sequence
MTKLESLLHASTGLSLISGYLMYNRRYLLSFDKKREGETTQSISVIIPARNEEKRLPKLL KSLSQQSMRVECIVMDDDSNDRTAEIAREMGAKVYNVTYDNNGNTWIGKSYACYLGASYT VSDILIFMDADVELNNEHALEAIIQSYARQQYRGLMSIQPYHVVYKPYEHLSAMFNLMTV VGTNSFSTLSKSKGESLAFGPVTVMNKSDYILTQGHKNAASHIIEGFSLGKAFQRCQLPV TRFEGQGFVSFRMYEAGFKTMIEGWTKHLAVGASSTQPHIMMLIILWMVGCITSFSGLAL SLFMKTLSFKRMALSYSLYTLQFIRLHRRVGRFSILFLAINSILFLVFILVYINSYRHIH YTKQVKWKGRQFSIK
Uniprot No.

Target Background

Function
Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, specifically the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, resulting in glycosyl-4,4'-diaponeurosporenoate. This enzymatic step is integral to the biosynthesis of staphyloxanthin, an orange pigment found in most staphylococci strains.
Database Links

KEGG: sha:SH0489

STRING: 279808.SH0489

Protein Families
Glycosyltransferase 2 family, CrtQ subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of 4,4'-diaponeurosporenoate glycosyltransferase (crtQ) in Staphylococcus haemolyticus?

4,4'-diaponeurosporenoate glycosyltransferase (crtQ) catalyzes a critical step in staphyloxanthin biosynthesis, specifically the glycosylation of 4,4'-diaponeurosporenoate. This reaction involves the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid to form glycosyl-4,4'-diaponeurosporenoate . This enzymatic process is essential for the production of staphyloxanthin, which is an orange pigment characteristically present in most staphylococci strains. The enzyme plays a crucial role in bacterial physiology, as staphyloxanthin functions as a virulence factor that protects Staphylococcus species against oxidative stress generated by host immune responses, thereby enhancing bacterial survival during infection.

What are the structural characteristics of crtQ protein from S. haemolyticus?

The crtQ protein from S. haemolyticus consists of 375 amino acid residues with a calculated molecular weight of approximately 42,808.43 Da . The protein has a theoretical isoelectric point (pI) of 9.513, indicating its basic nature. This enzyme belongs to the glycosyltransferase family, which typically features a nucleotide-binding domain important for catalytic activity. While detailed crystal structure information is not yet available specifically for S. haemolyticus crtQ, the enzyme likely adopts the characteristic fold of glycosyltransferases, with catalytic domains that coordinate substrate binding and transfer reactions. Understanding these structural features is essential for researchers investigating enzyme mechanisms and developing potential inhibitors targeting this pathway.

What are the optimal conditions for expressing recombinant S. haemolyticus crtQ in heterologous systems?

The optimal expression of recombinant S. haemolyticus crtQ requires careful consideration of host selection, vector design, and culture conditions. Based on approaches used for similar enzymes, expression in E. coli systems (BL21(DE3) or its derivatives) often provides good yields when the gene is codon-optimized for prokaryotic expression. Alternatively, insect cell expression systems using Sf9 cells with baculovirus vectors offer advantages for enzymes requiring post-translational modifications .

Temperature optimization is crucial, with expression typically performed at lower temperatures (16-25°C) to enhance proper folding. For optimal purification, incorporating affinity tags such as hexahistidine at either the N- or C-terminus facilitates rapid isolation using nickel-affinity chromatography without compromising enzyme activity . The table below summarizes recommended expression conditions based on comparable recombinant enzyme studies:

ParameterOptimal ConditionNotes
Expression hostE. coli BL21(DE3) or Sf9 cellsChoose based on folding complexity
VectorpET series (E. coli) or pAcHLT-B (Sf9)Include appropriate promoter and tag
Induction0.1-0.5 mM IPTG (E. coli) or MOI ≈5 (Sf9)Lower concentrations reduce inclusion bodies
Temperature18°C (E. coli) or 27°C (Sf9)Post-induction temperature critical for activity
Duration16-20 hours (E. coli) or 72 hours (Sf9)Extended expression at lower temperatures
Lysis buffer50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10% glycerolInclude protease inhibitors

How does the deletion of crtQ affect staphyloxanthin production and virulence in S. haemolyticus?

Deletion of the crtQ gene in S. haemolyticus results in significant disruption of the staphyloxanthin biosynthetic pathway, leading to colorless or pale colonies due to the inability to produce the characteristic orange pigment. This phenotypic change has substantial implications for bacterial virulence and survival. Without staphyloxanthin, S. haemolyticus exhibits increased susceptibility to oxidative stress, particularly hydrogen peroxide and superoxide radicals generated by neutrophils during host immune responses. Research demonstrates that crtQ-deficient strains show reduced survival in human blood and serum compared to wild-type strains, indicating compromised defense against immune clearance. Additionally, these mutants display attenuated virulence in animal infection models, with decreased bacterial loads in tissues and reduced abscess formation. The precise quantification of these effects requires experimental verification in S. haemolyticus specifically, as most published data comes from studies in S. aureus, where similar enzymes function in the staphyloxanthin pathway.

What mechanisms regulate the expression of crtQ in S. haemolyticus, and how do these compare to antibiotic resistance mechanisms?

The expression of crtQ in S. haemolyticus is regulated through multiple mechanisms that respond to environmental conditions. Unlike antibiotic resistance genes such as ermC, which can develop constitutive expression through leader peptide deletion , crtQ regulation appears to be primarily influenced by stress response systems. The sigma factor σB plays a significant role in modulating crtQ expression in response to environmental stressors, similar to its role in other staphylococcal species. Additionally, the two-component regulatory systems SaeRS and AgrAC influence crtQ expression in relation to quorum sensing and host environment adaptation.

In contrast to antibiotic resistance mechanisms like the constitutive macrolides-lincosamides-streptogramins resistance found in S. haemolyticus , crtQ regulation does not typically involve attenuation mechanisms dependent on leader peptides. Instead, transcription factors and regulatory proteins directly control promoter activity based on cellular needs and environmental conditions. This fundamental difference reflects the distinct evolutionary pressures on virulence factors versus antibiotic resistance determinants. While antibiotic resistance genes like ermC evolve rapidly under selective pressure from antimicrobials, often through mutations in regulatory regions , virulence-associated genes like crtQ typically maintain more conserved regulatory mechanisms focused on coordinating expression with other virulence factors.

What are the most effective protocols for purifying recombinant S. haemolyticus crtQ while maintaining enzymatic activity?

Purification of recombinant S. haemolyticus crtQ with preserved enzymatic activity requires a strategic approach that minimizes protein denaturation and oxidation. A multi-step purification protocol starting with affinity chromatography yields the best results. For hexahistidine-tagged constructs, immobilized metal affinity chromatography (IMAC) using nickel-NTA resin provides high selectivity in the initial purification step . The enzyme should be eluted with an imidazole gradient (20-250 mM) in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol to stabilize the protein structure.

Further purification can be achieved using ion exchange chromatography (given the theoretical pI of 9.513 ), followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein. Throughout the purification process, maintaining reducing conditions with 1-5 mM DTT or 2-mercaptoethanol helps prevent oxidation of critical cysteine residues. Temperature control is essential, with all steps performed at 4°C to minimize degradation. The table below outlines the recommended purification protocol:

Purification StepBuffer CompositionOperating ConditionsExpected Recovery
Ni-NTA Affinity50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 20-250 mM imidazoleFlow rate: 1 ml/min at 4°C70-80%
Ion Exchange (Q-Sepharose)20 mM Tris-HCl pH 8.0, 50-500 mM NaCl gradientFlow rate: 2 ml/min at 4°C60-70%
Size Exclusion25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTTFlow rate: 0.5 ml/min at 4°C>95%

Activity assays should be performed immediately after purification using a spectrophotometric method that monitors the formation of glycosyl-4,4'-diaponeurosporenoate. The enzyme typically retains >80% activity when stored at -80°C in storage buffer containing 25 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and 1 mM DTT.

How can researchers design valid experimental and quasi-experimental approaches to study crtQ function in S. haemolyticus?

Designing valid experimental approaches to study crtQ function in S. haemolyticus requires careful consideration of both experimental and quasi-experimental designs. For fully experimental designs, randomized controlled trials comparing wild-type to genetically modified strains provide the most robust evidence of enzyme function . These should include complete gene deletion mutants (ΔcrtQ), complemented strains, and point mutation variants affecting catalytic residues.

For quasi-experimental designs when randomization is not feasible, interrupted time series (ITS) approaches can be valuable, particularly for studying crtQ expression under various environmental conditions or antibiotic pressures . Pre-post designs with non-equivalent control groups are appropriate when comparing different clinical isolates with varying levels of crtQ expression or function. Stepped wedge designs can be employed when gradually introducing environmental stressors to evaluate their impact on crtQ activity .

Regardless of design, researchers should adhere to these methodological principles:

  • Clearly define primary and secondary outcomes (pigment production, oxidative stress resistance, virulence)

  • Ensure appropriate controls (including vector-only controls for recombinant studies)

  • Employ multiple complementary measurement techniques

  • Account for potential confounding variables

  • Incorporate time series measurements to capture dynamic responses

  • Use appropriate statistical methods to analyze results, including adjustment for multiple comparisons

Quantification of staphyloxanthin production using methanol extraction followed by spectrophotometric analysis (450-460 nm) provides a reliable readout of crtQ function. Additionally, enzyme activity can be directly measured by monitoring the conversion of 4,4'-diaponeurosporenoate to glycosyl-4,4'-diaponeurosporenoate using HPLC or LC-MS methods.

What are the most effective approaches for analyzing the relationship between crtQ activity and antibiotic resistance mechanisms in S. haemolyticus?

Investigating the relationship between crtQ activity and antibiotic resistance mechanisms in S. haemolyticus requires integrated experimental approaches that simultaneously assess both phenomena. The connection is particularly relevant since staphyloxanthin can affect membrane properties, potentially influencing antibiotic penetration and efflux pump function. Several methodological approaches are recommended:

  • Comparative transcriptomics/proteomics: RNA-Seq and LC-MS/MS proteomic analysis comparing wild-type and ΔcrtQ strains under antibiotic pressure can reveal coordinated regulation between staphyloxanthin biosynthesis and resistance mechanisms such as the ermC-mediated macrolide resistance . This approach identifies gene expression patterns that may reveal functional relationships.

  • Metabolic flux analysis: Isotope-labeled precursors can track carbon flow through the staphyloxanthin pathway and measure potential metabolic burden, similar to the fitness cost observed with ermC expression in antibiotic resistance . This helps quantify whether crtQ expression diverts resources from resistance mechanisms.

  • Membrane integrity studies: Fluorescent dye penetration assays comparing wild-type and ΔcrtQ strains with varying antibiotic resistance profiles can determine if staphyloxanthin affects membrane permeability to antibiotics. Fluorescence anisotropy measurements provide quantitative data on membrane fluidity changes.

  • Synergy testing: Using checkerboard assays to measure interactions between staphyloxanthin biosynthesis inhibitors and various antibiotics can reveal functional connections. Fractional inhibitory concentration (FIC) indices below 0.5 would suggest synergistic relationships between pigment inhibition and antibiotic sensitivity.

  • Evolutionary experimental designs: Serial passage experiments with and without antibiotic pressure can reveal if staphyloxanthin production is maintained alongside resistance development. Genome sequencing at multiple timepoints can identify mutations affecting both pathways.

The experimental results should be analyzed for statistical significance using appropriate methods like ANOVA with post-hoc tests for multiple comparisons or mixed-effects models for time series data. When designing these experiments, it is crucial to account for the potential fitness costs of both staphyloxanthin production and antibiotic resistance mechanisms, as observed with the ermC gene in S. haemolyticus .

What are common challenges in expressing functional recombinant S. haemolyticus crtQ and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant S. haemolyticus crtQ. Inclusion body formation is a common issue when expressing in E. coli systems, resulting in insoluble, non-functional enzyme. This can be addressed by optimizing expression conditions through reduced induction temperatures (16-18°C), lower IPTG concentrations (0.1-0.2 mM), and co-expression with chaperone proteins like GroEL/GroES. Alternatively, using Sf9 insect cells with a baculovirus expression system can significantly improve solubility and functional yield, as demonstrated with other recombinant enzymes .

Protein instability during purification is another significant challenge. Adding stabilizing agents such as 10% glycerol and 1 mM DTT to all buffers helps maintain enzyme conformation and activity. Some researchers have found that fusion tags beyond the standard hexahistidine, such as SUMO or MBP, can dramatically improve solubility while being removable by specific proteases after purification.

Loss of enzymatic activity during storage is also problematic. This can be mitigated by flash-freezing the purified enzyme in small aliquots with 20% glycerol and storing at -80°C. Avoiding repeated freeze-thaw cycles is critical for maintaining activity. For long-term storage studies, researchers should perform activity assays at regular intervals to establish a stability profile under different storage conditions.

How can researchers accurately measure and quantify the enzymatic activity of recombinant crtQ?

Accurate measurement of recombinant crtQ activity requires specialized assays that monitor either substrate consumption or product formation. The standard assay involves spectrophotometric monitoring of the reaction, measuring the decrease in absorbance of 4,4'-diaponeurosporenoate at 440 nm or the formation of glycosyl-4,4'-diaponeurosporenoate at 460 nm. For more precise quantification, HPLC or LC-MS methods can be employed to directly measure substrate-to-product conversion using standards for calibration.

A typical reaction mixture contains:

  • 50 mM Tris-HCl buffer (pH 7.5)

  • 5 mM MgCl₂

  • 1 mM DTT

  • 50-100 μM 4,4'-diaponeurosporenoate substrate

  • 1-2 mM UDP-glucose as the sugar donor

  • 0.5-5 μg purified enzyme

The enzyme activity is typically reported as μmol product formed per minute per mg of enzyme (U/mg). When developing kinetic parameters, varying substrate concentrations should be used to determine Km and Vmax values through Michaelis-Menten analysis. Researchers should be aware that product inhibition may occur, similar to the feedback inhibition observed with other biosynthetic enzymes . Control reactions without enzyme or with heat-inactivated enzyme are essential to account for non-enzymatic background reactions.

For high-throughput screening applications, a fluorescence-based assay can be developed using dansylated substrate analogs or coupled enzyme systems that produce measurable fluorescent products. This allows for rapid screening of multiple conditions or potential inhibitors in 96-well or 384-well plate formats.

How might crtQ inhibition be exploited as an anti-virulence strategy against S. haemolyticus infections?

Targeting crtQ represents a promising anti-virulence strategy against S. haemolyticus infections that could complement traditional antibiotic approaches. By inhibiting crtQ, researchers can disrupt staphyloxanthin biosynthesis, rendering the bacteria more susceptible to oxidative killing by host immune cells without directly affecting bacterial growth. This approach offers several advantages over conventional antimicrobials since it applies less selective pressure for resistance development.

Structure-based drug design focusing on the catalytic site of crtQ could yield selective inhibitors that block glycosyltransferase activity. Computational screening of compound libraries against homology models of S. haemolyticus crtQ can identify candidate molecules for experimental validation. Natural product libraries are particularly promising sources of glycosyltransferase inhibitors, as many plant-derived compounds have evolved to target similar enzymes.

Potential therapeutic benefits of crtQ inhibition include:

  • Enhanced neutrophil-mediated bacterial clearance through increased susceptibility to oxidative killing

  • Reduced bacterial persistence in host tissues

  • Potential synergy with existing antibiotics, particularly those affected by membrane properties

  • Lower risk of resistance development compared to growth-inhibitory antibiotics

Preliminary studies could evaluate combinations of sub-inhibitory antibiotic concentrations with crtQ inhibitors to identify synergistic pairs that maximize bacterial clearance while minimizing resistance development. This could be particularly valuable for addressing emerging resistance patterns in S. haemolyticus, such as the constitutive macrolides-lincosamides-streptogramins resistance phenotype recently identified .

What comparative genomic approaches can reveal the evolution and function of crtQ across different Staphylococcus species?

Comparative genomic approaches provide powerful tools for understanding the evolution and functional diversification of crtQ across Staphylococcus species. Whole-genome sequencing of multiple S. haemolyticus isolates, along with other staphylococcal species, can reveal selective pressures acting on the crtQ gene. By calculating dN/dS ratios (non-synonymous to synonymous substitution rates), researchers can determine if the gene is under purifying, neutral, or positive selection.

Synteny analysis comparing the genomic context of crtQ across species can identify conserved operonic structures or regulatory elements that control expression. This approach may reveal whether crtQ regulation is coordinated with other virulence factors or stress response systems. Identifying mobile genetic elements or recombination hotspots near crtQ can also explain patterns of horizontal gene transfer that might contribute to functional divergence.

Phylogenetic analysis of crtQ sequences from diverse staphylococcal species can reconstruct the evolutionary history of this enzyme family and identify species-specific adaptations. Ancestral sequence reconstruction techniques allow researchers to infer and potentially recreate ancestral crtQ variants to study the functional consequences of evolutionary changes. This evolutionary perspective can provide insights into how different Staphylococcus species have adapted their staphyloxanthin biosynthesis pathways to various ecological niches and host environments.

Metagenomic analyses of human microbiome samples can further reveal the distribution and abundance of crtQ variants in clinical and commensal staphylococcal populations, providing epidemiological context for functional studies. This information is particularly valuable for understanding how crtQ function might differ between pathogenic and non-pathogenic staphylococci.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.