Recombinant Staphylococcus haemolyticus Accessory gene regulator protein B (agrB)

Shipped with Ice Packs
In Stock

Description

Key Functional Roles:

FunctionMechanismRelevance to S. haemolyticus
AgrD ProcessingCleaves the C-terminal octapeptide of AgrD to generate AIP .Critical for autoinduction and quorum sensing .
AgrB-AgrD InteractionForms stable complexes in detergent micelles, confirmed via SRCD and SAXS .Required for AIP maturation and signal transduction .
AgrB DimerizationSelf-interacts via N- and C-terminal domains (split luciferase assays) .Suggests cooperative binding in quorum sensing .

Recombinant Expression and Experimental Validation

Recombinant agrB is typically produced in heterologous systems (e.g., Escherichia coli) to study its biochemical properties. Key methodologies include:

Recombinant Production Systems

SystemMethodKey Findings
E. coli MembranesExpression of His-tagged agrB; membrane isolation for in vitro assays .Demonstrated AgrB’s ability to process AgrD and generate AIP .
Split LuciferaseTagged agrB (N-/C-terminal LgBiT/SmBiT) to study interactions .Confirmed AgrB-AgrD binding specificity (C-terminal tagging critical) .

Role in S. haemolyticus Pathogenesis and Antibiotic Resistance

While S. haemolyticus agrB shares functional homology with S. aureus, its specific role in pathogenicity remains under investigation. Emerging evidence links agrB to:

AgrB and Virulence Regulation

  • Hemolysis and Exoprotein Production: In S. aureus, agrB regulates α-hemolysin and PSMs via RNAIII/AgrA . S. haemolyticus strains with disrupted agr systems show reduced hemolysis and virulence .

  • Biofilm Formation: S. haemolyticus biofilms often contain extracellular DNA (eDNA) harboring antibiotic resistance genes (ARGs), potentially influenced by agrB-mediated quorum sensing .

AgrB and Antibiotic Resistance

Resistance MechanismAssociated GenesConnection to agrB
MLS ResistanceermC, mphC, msrAConstitutive ermC expression linked to agrB-mediated stress responses .
β-Lactam ResistanceblaZ, mecAHorizontal gene transfer (HGT) of β-lactamase genes via IS elements .

Research Gaps and Future Directions

  1. Structural Characterization: Crystallographic resolution of S. haemolyticus agrB remains unexplored, limiting insights into species-specific interactions.

  2. Clinical Relevance: No direct studies correlate agrB polymorphisms with S. haemolyticus pathogenicity or treatment outcomes.

  3. Therapeutic Targets: Inhibiting agrB-AgrD interactions could disrupt quorum sensing, but in vivo efficacy in S. haemolyticus is untested .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
agrB; SH0996; Accessory gene regulator protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
agrB
Target Protein Sequence
MKAIDNKIEQFALYLQRKNNLDHIQFLKVRLGLQVVVSNLAKTIVTYGVALIFHTFLYTL FTHVSYFLVRRYAHGAHAKSSLLCHVQNLALFVALPWLLVYFQVNLGIMYSVVAIGTVLI IYYAPSATKKQPIPSHLKMKKKLLSIIITMVLLIISFLAPEPFKQLILLGITLESITLLP IFFPREDN
Uniprot No.

Target Background

Function
Essential for the production of a quorum sensing system signal molecule, the autoinducing peptide (AIP). This quorum sensing system regulates the expression of virulence factor genes. Involved in the proteolytic processing of AgrD, the precursor of AIP.
Database Links

KEGG: sha:SH0996

STRING: 279808.SH0996

Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Accessory Gene Regulator (agr) system and what role does AgrB play within it?

The accessory gene regulator (agr) is a complex 5-gene locus that functions as a global regulator of virulence in staphylococcal species, including both S. aureus and S. haemolyticus. This system operates as a two-component transcriptional quorum-sensing (QS) mechanism activated by autoinducing peptides (AIPs) .

Within this system, AgrB serves as a transmembrane endopeptidase responsible for the initial processing of the AgrD pro-peptide to generate the AIP signaling molecule . The agr locus comprises two adjacent transcripts, RNAII and RNAIII, controlled by P2 and P3 promoters respectively. RNAII encodes four proteins: AgrB, AgrD, AgrC, and AgrA, with AgrB and AgrD being critical for AIP production .

What are the key structural features of AgrB that enable its function?

Structural studies using homology modeling and molecular dynamics (MD) simulations have revealed that AgrB possesses a six helical transmembrane domain (6TMD) topology . This structure is critical for its function as a membrane-embedded peptidase.

Key structural features include:

  • Six transmembrane helices anchoring the protein in the bacterial membrane

  • Active sites for endopeptidase activity

  • Domains that facilitate interaction with the AgrD substrate

  • Regions that enable AgrB dimerization

Experimental evidence from split luciferase assays confirms that AgrB can interact directly with itself to form dimers and with AgrD to form processing complexes . The specific conformation of AgrB undergoes alteration following interaction with AgrD, as observed through small angle analysis and synchrotron radiation CD (SRCD) .

What are the optimal conditions for expression and purification of recombinant S. haemolyticus AgrB?

For successful expression and purification of recombinant S. haemolyticus AgrB, researchers should follow these methodological guidelines:

  • Expression System: E. coli is the preferred heterologous expression system for recombinant AgrB production .

  • Protein Tags: N-terminal His-tagging is commonly employed to facilitate purification while maintaining protein function. The specific tag type may be determined during the production process based on experimental requirements .

  • Purification Protocol:

    • Use affinity chromatography with Ni-NTA columns for His-tagged proteins

    • Ensure greater than 90% purity as determined by SDS-PAGE

    • Store in appropriate buffer conditions (e.g., Tris-based buffer with 50% glycerol)

  • Storage Recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot for multiple use to avoid repeated freeze-thaw cycles

    • For working stocks, maintain aliquots at 4°C for up to one week

  • Reconstitution Guidelines:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

How can I design experiments to study AgrB-AgrD interactions in vitro?

To effectively study AgrB-AgrD interactions, researchers have employed several complementary approaches:

  • Split Luciferase Assays:

    • This method provides direct evidence of protein-protein interactions in vivo

    • Particularly valuable for confirming AgrB self-interaction (dimerization) and AgrB-AgrD binding in S. aureus

    • Can be adapted for S. haemolyticus proteins

  • Western Blotting for Complex Detection:

    • Express AgrB in E. coli membranes

    • Incubate with purified T7-tagged AgrD

    • Detect complex formation and AIP production via Western blotting

  • Biophysical Characterization:

    • Synchrotron radiation CD (SRCD) to analyze stable complex formation in detergent micelles

    • Landau analysis to assess thermal stability (AgrB shows enhanced thermal stability in the presence of AgrD)

    • Small angle analysis to observe conformational changes in AgrB following AgrD binding

  • Molecular Dynamics Simulations:

    • Employ homology modeling and MD annealing to characterize conformations of AgrB and AgrD in model membranes and in solution

    • In silico membrane complexes can reveal how dimeric AgrB interacts with AgrD, showing non-equivalent AgrB monomers responsible for initial binding and processing respectively

What statistical considerations should be applied when designing experiments involving recombinant AgrB?

When designing experiments to study recombinant AgrB function or interactions, several statistical considerations should be addressed:

  • Balanced vs. Unbalanced Designs:

    • While balanced designs are commonly used in agricultural and biological experiments to mitigate violations of homogeneity assumptions, unbalanced designs may provide better statistical power in certain scenarios

    • For experiments measuring AgrB-AgrD interaction kinetics or processing efficiency, consider whether equal sample sizes or optimized distribution of experimental units would yield more reliable results

  • Adaptive Design Approaches:

    • Rather than designing an experiment all at once, consider allocating a portion of the total sample size first

    • Analyze preliminary data to update your understanding

    • Design subsequent phases of the experiment using this updated knowledge

    • This approach is particularly valuable for pilot studies investigating novel aspects of AgrB function

  • Sample Size Considerations:

    • Large sample sizes help mitigate violations of normality assumptions but not homogeneity assumptions

    • When comparing different AgrB variants or experimental conditions, the optimal distribution of resources may not be equal allocation

  • Accounting for Technical Challenges:

    • Membrane protein experiments often have higher variability

    • Plan for potential sample loss during purification and reconstitution

    • The Tukey-Kramer method can adjust calculations of standard error to account for unequal sample sizes resulting from unexpected data loss

How can I design allelic replacement strains to study AgrB function in vivo?

Creating allelic replacement strains is a powerful approach for studying AgrB function in its native context. The methodology below can be adapted from S. aureus to S. haemolyticus:

  • Construction Procedure:

    • Amplify the agrBDC fragment from donor strain via PCR

    • Insert the fragment into appropriate restriction sites (e.g., SalI and BamHI) of a shuttle vector like pBT2

    • Introduce the resulting vector into an intermediate strain (equivalent to S. aureus RN4220) for proper methylation

    • Transform the plasmid into the target deletion mutant strain

    • Allow homologous recombination to occur

    • Verify substitution by PCR amplification and DNA sequencing

  • Specific Considerations for S. haemolyticus:

    • Optimize transformation protocols for S. haemolyticus

    • Ensure vector compatibility with S. haemolyticus replication machinery

    • Consider species-specific codon usage when designing constructs

  • Phenotypic Assessment:

    • Evaluate virulence factor expression

    • Measure AIP production

    • Assess quorum sensing signal transmission

    • Test antibiotic resistance profiles

    • Compare growth characteristics

What approaches can be used to analyze the topology and membrane integration of AgrB?

Understanding AgrB's membrane topology is crucial for elucidating its mechanism of action. Several complementary approaches can be employed:

How does S. haemolyticus AgrB function compare to S. aureus AgrB in terms of substrate specificity and processing efficiency?

The functional comparison between S. haemolyticus and S. aureus AgrB proteins reveals important differences and similarities:

  • Substrate Recognition:

    • Both recognize and process their cognate AgrD propeptides

    • Sequence variations in the transmembrane domains may influence substrate binding specificity

    • S. haemolyticus AgrB (MKAIDNKIEQ...) has a different N-terminal sequence compared to S. aureus AgrB (MNYFDNKIDQ...), potentially affecting interactions with the AgrD N-terminus

  • Enzymatic Activity:

    • Both function as endopeptidases (EC 3.4.-.-)

    • Process AgrD to generate species-specific AIPs

    • May exhibit different processing kinetics due to structural variations

  • Processing Mechanism:

    • AgrB proteins form dimers with non-equivalent monomers

    • One monomer is responsible for initial binding while the other performs processing

    • This mechanism appears conserved across staphylococcal species but with potential variations in efficiency

  • Cross-species Compatibility:

    • Limited cross-reactivity between different species' AgrB-AgrD pairs

    • Species-specific processing is important for maintaining signaling specificity

    • Chimeric constructs combining domains from different species' AgrB proteins can help identify regions critical for substrate recognition

How does AgrB contribute to the pathogenicity and antibiotic resistance of clinical S. haemolyticus isolates?

The role of AgrB in S. haemolyticus pathogenicity and antibiotic resistance is multifaceted:

  • Clinical Relevance:

    • In a study of 123 clinical and 46 commensal S. haemolyticus isolates, multi-drug resistance (MDR) was detected in 88% of clinical isolates compared to only 11% of commensal isolates (p < 0.05)

    • Clinical isolates showed specific genetic signatures distinguishing them from commensal strains

  • Biofilm Formation:

    • Biofilm-forming S. haemolyticus isolates that are resistant to oxacillin (mecA) and aminoglycosides (aacA-aphD) are more likely to be invasive isolates

    • Absence of these traits strongly indicates a commensal isolate

    • The agr system, including AgrB, plays a role in regulating biofilm formation

  • Virulence Regulation:

    • AgrB is essential for generating the AIP that activates the agr quorum sensing system

    • This system regulates virulence factor expression in a cell density-dependent manner

    • Similar to S. aureus, the S. haemolyticus agr system likely controls the expression of adhesins early in growth and toxins later in growth

  • Hospital Adaptation:

    • Clinical S. haemolyticus isolates show specific signatures associated with successful hospital adaptation

    • These include acquisition of mobile genetic elements and beneficial mutations in surface-associated genes

    • The agr system may contribute to these adaptations by regulating gene expression patterns

What is known about AgrB polymorphisms across different staphylococcal species and their functional implications?

AgrB exhibits significant polymorphisms across staphylococcal species and even within different strains of the same species:

  • Allelic Variation:

    • In S. aureus, four major agr allelic groups (I-IV) have been identified

    • These groups are characterized by polymorphisms in AgrB, AgrD, and AgrC, while AgrA, RNAIII, and their promoter regions remain highly conserved

    • Similar allelic variation likely exists in S. haemolyticus

  • Cross-Inhibition:

    • AIPs from different agr groups can be mutually cross-inhibitory

    • This cross-inhibition may enhance evolutionary separation of the different groups

    • The specificity of cross-inhibition is determined by the molecular recognition between AgrB-processed AIPs and their cognate AgrC receptors

  • Evolutionary Implications:

    • Polymorphisms in AgrB likely arose from selective pressures related to niche adaptation

    • These variations enable specificity in quorum sensing signals

    • The persistence of multiple allelic variants suggests they provide adaptive advantages in different environmental contexts

  • Functional Consequences:

    • Different AgrB variants may exhibit variations in processing efficiency, substrate specificity, or stability

    • These functional differences can influence virulence factor expression patterns

    • Understanding these polymorphisms is essential for developing targeted anti-virulence strategies

What are common challenges in working with recombinant AgrB and how can they be addressed?

Researchers working with recombinant AgrB frequently encounter several technical challenges:

  • Protein Solubility and Stability:

    • Challenge: As a transmembrane protein, AgrB has hydrophobic domains that make it difficult to maintain in solution

    • Solution: Use appropriate detergents (e.g., n-dodecyl-β-D-maltoside) or lipid nanodiscs for extraction and stabilization

    • Recommendation: Store in buffer containing 50% glycerol at -20°C/-80°C and avoid repeated freeze-thaw cycles

  • Expression Yield:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize expression conditions (temperature, induction timing, media composition)

    • Recommendation: Consider using specialized E. coli strains designed for membrane protein expression

  • Functional Assessment:

    • Challenge: Confirming that recombinant AgrB retains its native activity

    • Solution: Develop in vitro processing assays using synthetic AgrD peptides

    • Recommendation: Incorporate positive controls using well-characterized AgrB variants

  • Protein-Protein Interaction Studies:

    • Challenge: Detecting AgrB-AgrD interactions in a membrane context

    • Solution: Use multiple complementary methods (split luciferase assays, Western blotting, SRCD)

    • Recommendation: Form stable complexes in detergent micelles for biophysical characterization

How can I optimize experimental designs when studying AgrB function in different genetic backgrounds?

When investigating AgrB function across different genetic backgrounds, consider these methodological optimizations:

  • Control Selection:

    • Include appropriate positive and negative controls specific to each genetic background

    • Use isogenic strains differing only in the agrB gene when possible

    • Consider including an agrB deletion mutant as a baseline control

  • Statistical Design Considerations:

    • An unbalanced design may be more appropriate than a balanced design in certain scenarios

    • With limited resources, adaptive designs allow optimization of experimental unit distribution

    • Use preliminary data from initial phases to design subsequent experiments more effectively

  • Phenotypic Readouts:

    • Select phenotypic assays relevant to the specific staphylococcal species being studied

    • Standardize conditions across different genetic backgrounds to ensure comparability

    • Consider multiple readouts (e.g., virulence factor production, biofilm formation, antibiotic resistance)

  • Genetic Background Effects:

    • Account for potential epistatic interactions between agrB and other genes

    • Consider how genetic background might influence AgrB expression, stability, or function

    • Document any strain-specific variations in experimental outcomes

Genetic BackgroundRecommended ControlsKey Phenotypic ReadoutsSpecial Considerations
S. aureusRN4220, NewmanHemolysis, protease activityWell-characterized agr groups I-IV
S. haemolyticusJCSC1435Biofilm formation, antibiotic resistanceLess characterized than S. aureus
Allelic replacement strainsParent strain, ΔagrB mutantAIP production, virulence factor expressionVerify replacement by sequencing
Clinical isolatesMatched commensal strainsAntibiotic resistance profiles, biofilm capacityHigh genetic diversity requires careful selection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.