Recombinant Staphylococcus haemolyticus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

PlsY catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), the first committed step in bacterial phosphatidic acid synthesis . Unlike acyl-CoA-dependent acyltransferases in Gram-negative bacteria, PlsY in Gram-positive species like S. haemolyticus exclusively uses acyl-phosphate as a substrate, reflecting adaptation to environments lacking acyl-CoA synthetases . This enzyme is essential for membrane biogenesis and regulates fatty acid incorporation into phospholipids.

Substrate Specificity and Inhibition

PlsY exhibits strict substrate selectivity:

Substrate TypeUtilization by PlsY
Acyl-phosphateYes
Acyl-CoANo
Acyl-ACPNo

Palmitoyl-CoA acts as a noncompetitive inhibitor, suggesting regulatory feedback mechanisms .

Biotechnological and Therapeutic Implications

  • Antibiotic Target: As a conserved enzyme in Gram-positive pathogens, PlsY is a potential target for novel antibacterials. Inhibitors disrupting its activity could impair membrane synthesis .

  • Stress Response Link: Downregulation of stress-response genes (e.g., clpB, dnaK) in S. haemolyticus by compounds like qy17 highlights interconnected pathways involving membrane integrity .

Research Gaps and Future Directions

Direct characterization of S. haemolyticus PlsY remains sparse. Key unanswered questions include:

  • Structural determination via cryo-EM or X-ray crystallography.

  • Kinetic parameters (Km, Vmax) for acyl-phosphate substrates.

  • Species-specific regulatory mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SH1555; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
plsY
Target Protein Sequence
MMIVVMLILSYLIGAIPNGYVIGKLFFKKDIRQYGSGNTGATNSFRVLGKPAGFIVTFLD IFKGFITVFFPIWFPVHADGPLSTFFTHGLIVGLFAILGHVYPIYLRFKGGKAVATSAGV VLGVNPILLLILAIIFFGVLYIFKYVSLSSIIAAICCVIGSLIIQDYILFGMSLLVSIIL IVRHRTNIVRIFKGEEPKIKWM
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links

KEGG: sha:SH1555

STRING: 279808.SH1555

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of glycerol-3-phosphate acyltransferase (plsY) in Staphylococcus haemolyticus?

Glycerol-3-phosphate acyltransferase (plsY) in S. haemolyticus is an integral membrane protein that catalyzes a critical step in bacterial membrane phospholipid biosynthesis. Specifically, plsY transfers acyl groups from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid, an essential precursor in phospholipid synthesis. This reaction represents one of the most widely distributed pathways to initiate phosphatidic acid formation in bacterial membrane phospholipid biosynthesis. The process involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the transfer of the acyl group from acylphosphate to glycerol-3-phosphate by PlsY . This enzyme plays a rate-limiting role in the de novo pathway of glycerolipid synthesis, making it crucial for bacterial cell membrane integrity and function.

How does the structure of plsY in S. haemolyticus compare to other bacterial species?

While specific structural data for S. haemolyticus plsY is limited, comparative analysis with other bacterial species (particularly Streptococcus pneumoniae) reveals that plsY typically contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane. Each of the three larger cytoplasmic domains contains highly conserved sequence motifs that are critical for catalytic function. These include:

  • Motif 1: Contains essential serine and arginine residues

  • Motif 2: Exhibits characteristics of a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site

  • Motif 3: Contains conserved histidine and asparagine residues important for activity, and a glutamate critical to structural integrity

The genomic analysis of S. haemolyticus reveals significant conservation in gene sequence and order when compared to other staphylococcal species like S. aureus and S. epidermidis, suggesting structural similarities in their essential proteins, including plsY .

What experimental methods are commonly used to express and purify recombinant S. haemolyticus plsY?

The expression and purification of recombinant S. haemolyticus plsY typically follows standard molecular biology techniques with specific modifications for membrane proteins. The recommended methodology includes:

  • Gene amplification using PCR with specifically designed primers containing appropriate restriction enzyme sites (similar to the approach used for other bacterial genes as shown in Table 1) :

GenePrimer designRestriction sites
plsYForward primer with BamHI siteBamHI for 5' end
plsYReverse primer with EcoRI siteEcoRI for 3' end
  • Cloning into an expression vector (commonly pET-28a) after restriction enzyme digestion and ligation

  • Transformation into an appropriate E. coli expression strain

  • Induction of protein expression using IPTG

  • Cell lysis and membrane fraction isolation via ultracentrifugation

  • Membrane protein solubilization using mild detergents

  • Purification via affinity chromatography (typically His-tag based purification)

  • Verification of purified protein via SDS-PAGE and Western blotting

Due to the integral membrane nature of plsY, special considerations for membrane protein handling are necessary throughout the purification process.

How does genomic instability in S. haemolyticus affect plsY function and expression?

S. haemolyticus exhibits remarkable genomic plasticity due to the presence of numerous insertion sequences (IS), with as many as 82 insertion sequences identified in its chromosome. These IS elements, particularly IS1272, mediate frequent genomic rearrangements resulting in phenotypic diversification . This genomic instability has significant implications for plsY function and expression:

  • Transposition events involving IS1272 have been observed to cause changes in clinically relevant phenotypic traits during serial growth in vitro, including alterations in mannitol fermentation, susceptibility to beta-lactams, biofilm formation, and hemolysis .

  • Such genomic rearrangements could potentially affect the expression levels or functional properties of membrane-associated proteins like plsY, particularly if IS elements insert near the plsY gene or its regulatory regions.

  • The genomic plasticity conferred by these IS elements is believed to contribute to S. haemolyticus' acquisition of antibiotic resistance mechanisms, which may indirectly influence membrane composition and thus the environment in which plsY functions .

  • The oriC environ region, which shows little homology among staphylococcal species but is conserved within species, may contain regulatory elements affecting species-specific genes, potentially including those involved in membrane lipid biosynthesis pathways .

Researchers investigating plsY in S. haemolyticus must therefore consider the potential for strain-to-strain variation and even within-strain evolution during experimentation due to this inherent genomic instability.

What are the key methodological considerations for assessing plsY enzymatic activity in S. haemolyticus?

Assessing plsY enzymatic activity in S. haemolyticus requires careful methodological planning due to its membrane-bound nature and the specific reaction it catalyzes. Key considerations include:

  • Substrate preparation:

    • Acylphosphate is unstable and must be freshly prepared or generated in situ

    • Radiolabeled or fluorescently labeled glycerol-3-phosphate can be used for sensitive detection of product formation

  • Membrane fraction isolation:

    • Careful separation of membrane fractions is essential to retain enzymatic activity

    • Detergent selection is critical—mild non-ionic detergents like n-dodecyl-β-D-maltoside may preserve activity while solubilizing the enzyme

  • Activity assay conditions:

    • Buffer composition (typically phosphate or Tris buffer)

    • pH optimization (generally pH 7.0-8.0)

    • Divalent cation requirements (Mg²⁺ is often necessary)

    • Temperature control (30-37°C is typically optimal)

  • Product detection methods:

    • Thin-layer chromatography (TLC) separation followed by autoradiography for radiolabeled substrates

    • LC-MS/MS for precise quantification of lysophosphatidic acid production

    • Coupled enzyme assays that link product formation to a spectrophotometric readout

  • Inhibition studies:

    • Palmitoyl-CoA has been identified as a noncompetitive inhibitor of plsY in other bacterial species and can be used to confirm specific activity

    • Site-directed mutagenesis of conserved motifs (similar to those identified in S. pneumoniae) can provide insights into catalytic mechanism

When interpreting results, researchers should account for the potential genomic instability of S. haemolyticus strains and consider confirming findings across multiple isolates or clones.

How can site-directed mutagenesis of S. haemolyticus plsY inform structure-function relationships?

Site-directed mutagenesis of S. haemolyticus plsY represents a powerful approach to elucidate structure-function relationships within this important membrane protein. Based on studies in related bacterial species, researchers should focus on:

  • Targeting conserved motifs:

    • Motif 1: Mutations of conserved serine and arginine residues, which are essential for catalytic activity

    • Motif 2: Mutations of conserved glycines in the phosphate-binding loop, which when converted to alanines result in defects in glycerol-3-phosphate binding

    • Motif 3: Mutations of conserved histidine, asparagine, and glutamate residues, which are critical for activity and structural integrity

  • Methodological approach:

    • PCR-based mutagenesis using primers containing the desired mutations

    • Verification of mutations by DNA sequencing

    • Expression of mutant proteins in a heterologous system

    • Functional characterization through enzymatic assays

    • Structural analysis using techniques like circular dichroism or limited proteolysis to assess folding

  • Expected outcomes and interpretation:

    • Kinetic parameters (Km, Vmax) for mutants compared to wild-type enzyme

    • Substrate specificity changes resulting from mutations

    • Correlation between conservation level of residues and functional impact of mutations

    • Identification of residues involved in catalysis versus those important for structural stability

This systematic mutagenesis approach can yield valuable insights into the catalytic mechanism of plsY and potentially identify residues that could be targeted for the development of specific inhibitors against S. haemolyticus plsY.

What is the relationship between plsY function and antibiotic resistance in S. haemolyticus?

The relationship between plsY function and antibiotic resistance in S. haemolyticus is complex and multifaceted, involving both direct and indirect mechanisms:

  • Membrane composition effects:

    • PlsY catalyzes a critical step in phospholipid biosynthesis, directly affecting membrane composition

    • Alterations in membrane phospholipid composition can affect membrane permeability to antibiotics, particularly hydrophobic compounds

    • Changes in membrane fluidity resulting from modified phospholipid composition can impact the function of membrane-bound antibiotic efflux pumps

  • Genomic context considerations:

    • S. haemolyticus is remarkable for its highly antibiotic-resistant phenotype

    • The extensive presence of insertion sequences (up to 82 IS elements) in the S. haemolyticus chromosome mediates frequent genomic rearrangements

    • These rearrangements may bring about changes in the expression of plsY or other genes involved in phospholipid biosynthesis, potentially contributing to the antibiotic resistance phenotype

  • Experimental evidence from related systems:

    • In other bacterial species, inhibition of phospholipid biosynthesis pathways has been shown to increase susceptibility to certain antibiotics

    • Genomic rearrangements in S. haemolyticus have been observed to cause changes in susceptibility to beta-lactams

    • The coordinated regulation of membrane composition and antibiotic resistance mechanisms suggests a functional interrelationship

  • Research implications:

    • PlsY could potentially serve as a target for adjuvant therapy to enhance antibiotic efficacy

    • Understanding the regulatory mechanisms connecting plsY expression to antibiotic resistance phenotypes may reveal novel intervention strategies

    • Monitoring plsY sequence and expression levels in clinical isolates with varying antibiotic resistance profiles could identify correlations of clinical significance

This relationship highlights the potential of targeting membrane phospholipid biosynthesis as a strategy to combat antibiotic resistance in S. haemolyticus.

How should researchers design experiments to study the impact of plsY knockdown or overexpression in S. haemolyticus?

Designing experiments to study plsY knockdown or overexpression in S. haemolyticus requires careful consideration of the genetic manipulation techniques applicable to this organism, as well as appropriate phenotypic assays. A comprehensive experimental design should include:

  • Genetic manipulation strategies:

    For knockdown:

    • Antisense RNA expression targeting plsY mRNA

    • CRISPR interference (CRISPRi) with catalytically inactive Cas9 targeted to the plsY promoter region

    • Inducible expression systems to create conditional knockdowns if plsY is essential

    For overexpression:

    • Construction of recombinant plasmids containing plsY under control of inducible promoters

    • Integration of additional plsY copies into the chromosome at neutral sites

    • Use of strong constitutive promoters to drive high-level expression

  • Verification methods:

    • qRT-PCR to confirm mRNA level changes

    • Western blotting to verify protein level alterations

    • Enzyme activity assays to assess functional consequences

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Membrane phospholipid composition analysis via mass spectrometry

    • Antibiotic susceptibility testing against multiple classes of antibiotics

    • Biofilm formation assays

    • Virulence assessment in cellular infection models

    • Membrane permeability assays using fluorescent dyes

  • Controls and considerations:

    • Include appropriate vector-only controls

    • Use multiple independent transformants to account for potential off-target effects

    • Consider the genomic instability of S. haemolyticus when interpreting results

    • Validate findings across different clinical isolates to ensure generalizability

    • Include complementation experiments to confirm phenotype specificity to plsY alteration

This experimental framework provides a comprehensive approach to understanding the physiological role of plsY in S. haemolyticus and its potential as a therapeutic target.

What are the optimal conditions for assessing plsY substrate specificity in S. haemolyticus?

Determining the substrate specificity of S. haemolyticus plsY requires careful experimental design to account for the membrane-bound nature of the enzyme and the characteristics of its substrates. Optimal conditions include:

  • Preparation of enzyme source:

    • Purified recombinant plsY in appropriate detergent micelles

    • Membrane fractions enriched for plsY expression

    • Whole cells with permeabilized outer membranes for in situ activity measurements

  • Substrate panel preparation:

    • Acylphosphate donors with varying chain lengths (C8-C20)

    • Saturated versus unsaturated acyl chains

    • Branched-chain versus straight-chain acyl donors

    • Glycerol-3-phosphate analogs with modifications at different positions

  • Reaction conditions optimization:

    • Buffer composition screening (phosphate, Tris, HEPES)

    • pH range testing (typically pH 6.5-8.5)

    • Divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺)

    • Temperature optimization (25-42°C)

    • Detergent type and concentration (if using purified enzyme)

  • Analytical methods:

    • HPLC or TLC separation of reaction products

    • Mass spectrometry for product identification and quantification

    • Radiometric assays using labeled substrates for enhanced sensitivity

    • Continuous spectrophotometric assays for real-time kinetic measurements

  • Data analysis approach:

    • Determination of kinetic parameters (Km, Vmax, kcat) for each substrate

    • Calculation of specificity constants (kcat/Km) to rank substrate preferences

    • Construction of substrate specificity profiles

    • Comparison with plsY enzymes from other bacterial species

  • Experimental controls:

    • Heat-inactivated enzyme controls

    • Known inhibitors (e.g., palmitoyl-CoA) to confirm specific activity

    • Parallel assays with well-characterized plsY from other species

This methodical approach will provide comprehensive insights into the substrate preferences of S. haemolyticus plsY, which may differ from those of other bacterial species due to the unique membrane composition requirements of this pathogen.

How can researchers effectively study the interaction between plsY and other components of the phospholipid biosynthesis pathway in S. haemolyticus?

Studying interactions between plsY and other components of the phospholipid biosynthesis pathway in S. haemolyticus requires a multi-faceted approach combining molecular, biochemical, and biophysical techniques:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation with antibodies against plsY or tagged versions of plsY

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Proximity labeling approaches (BioID or APEX2) with plsY as the bait protein

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

  • Genetic interaction approaches:

    • Synthetic genetic array analysis using conditional mutations

    • Suppressor mutation screening to identify compensatory pathways

    • Co-expression analysis to identify genes with similar expression patterns

    • Epistasis analysis between plsY and other pathway genes

  • Structural biology techniques:

    • Cryo-electron microscopy of membrane fractions enriched in phospholipid biosynthesis proteins

    • X-ray crystallography of co-purified protein complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • NMR studies of labeled proteins in membrane mimetics

  • Metabolic labeling and flux analysis:

    • Pulse-chase experiments with labeled precursors

    • Metabolic flux analysis using stable isotope labeling

    • Lipidomics analysis under conditions of altered plsY expression or activity

    • In vitro reconstitution of partial pathways with purified components

  • Computational approaches:

    • Molecular docking simulations between plsY and potential interacting partners

    • Coevolution analysis to identify correlated mutation patterns

    • Molecular dynamics simulations of plsY in membrane environments

    • Network analysis of phospholipid biosynthesis pathways

Through these approaches, researchers can build a comprehensive understanding of how plsY functions within the broader context of phospholipid biosynthesis in S. haemolyticus, potentially revealing novel regulatory mechanisms and interaction partners that could serve as additional therapeutic targets.

How should researchers interpret contradictory findings regarding plsY function across different S. haemolyticus strains?

When researchers encounter contradictory findings regarding plsY function across different S. haemolyticus strains, a systematic analytical approach is essential. The interpretation should consider:

  • Genomic heterogeneity considerations:

    • S. haemolyticus demonstrates remarkable genomic plasticity due to the presence of numerous insertion sequences (up to 82 IS elements)

    • Different strains may contain varying numbers and locations of these IS elements, potentially affecting plsY expression or function

    • The chromosome of S. haemolyticus has been observed to be highly unstable even during serial growth in vitro

    • Whole genome sequencing of the specific strains used should be performed to identify potential structural variations in or around the plsY gene

  • Experimental context evaluation:

    • Growth conditions (media composition, temperature, oxygen availability) can significantly impact membrane composition requirements

    • Experimental timepoints may capture different phases of adaptation or evolution

    • In vitro versus in vivo conditions may elicit different functional behaviors of plsY

    • Technical variables in enzyme assays should be scrutinized (substrate preparation, detergent effects, buffer conditions)

  • Statistical analysis approaches:

    • Biological replicates versus technical replicates should be clearly distinguished

    • Appropriate statistical tests should be applied based on data distribution

    • Effect size calculations can help determine biological significance beyond statistical significance

    • Meta-analysis techniques can be applied if multiple studies are available

  • Reconciliation strategies:

    • Identify strain-specific regulatory mechanisms that might explain functional differences

    • Consider post-translational modifications that might differ between strains

    • Examine the membrane lipid composition of contradictory strains for correlations

    • Perform complementation experiments by expressing plsY from one strain in another

  • Reporting recommendations:

    • Clearly document strain origins, passage history, and growth conditions

    • Provide complete methodological details to facilitate replication

    • Present both confirmatory and contradictory data transparently

    • Discuss limitations and alternative interpretations of the findings

This approach acknowledges that S. haemolyticus strain heterogeneity is biologically meaningful rather than merely experimental noise, potentially revealing important insights about the adaptive flexibility of plsY function in different genomic contexts.

What statistical approaches are most appropriate for analyzing plsY inhibition studies in S. haemolyticus?

When analyzing plsY inhibition studies in S. haemolyticus, researchers should employ rigorous statistical approaches tailored to the specific experimental design and data characteristics:

  • Dose-response curve analysis:

    • Nonlinear regression to determine IC50 values

    • Four-parameter logistic model fitting for complete dose-response curves

    • Comparison of curve parameters (top, bottom, Hill slope, IC50) between different inhibitors

    • Statistical tests for parallelism to identify different mechanisms of inhibition

  • Enzyme kinetics analysis:

    • Linear transformations (Lineweaver-Burk, Eadie-Hofstee, Hanes-Woolf) for visual inspection of inhibition mechanisms

    • Direct nonlinear regression of untransformed data for more accurate parameter estimation

    • Statistical tests to distinguish between competitive, noncompetitive, and uncompetitive inhibition

    • Global fitting of multiple datasets with shared parameters to increase precision

  • Time-dependent inhibition analysis:

    • Progress curve analysis to identify time-dependent inhibition

    • Kitz-Wilson plots for determining kinact and KI values

    • Statistical comparison of kinact/KI ratios between inhibitors

    • Bootstrapping approaches for confidence interval estimation

  • Structure-activity relationship (SAR) analysis:

    • Multiple linear regression for quantitative structure-activity relationships

    • Principal component analysis to identify key structural features affecting inhibition

    • Hierarchical clustering to group inhibitors by mechanism or potency

    • Cross-validation techniques to assess predictive power of SAR models

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures to minimize bias

    • Inclusion of appropriate positive and negative controls

    • Assessment of assumptions (normality, homoscedasticity) for parametric tests

  • Reporting recommendations:

    • Present both raw data and fitted curves/parameters

    • Report 95% confidence intervals for all estimated parameters

    • Include goodness-of-fit statistics (R², residual plots)

    • Provide clear justification for the selected statistical methods

How can structural insights about S. haemolyticus plsY inform the development of targeted antimicrobial agents?

Structural insights about S. haemolyticus plsY can significantly accelerate the development of targeted antimicrobial agents through rational drug design approaches:

  • Exploiting catalytic site architecture:

    • The three conserved motifs identified in bacterial plsY proteins (particularly in S. pneumoniae) provide critical starting points for inhibitor design

    • Motif 1 contains essential serine and arginine residues that likely participate directly in catalysis

    • Motif 2 functions as a phosphate-binding loop and interacts with glycerol-3-phosphate

    • Motif 3 contains conserved histidine, asparagine, and glutamate residues essential for activity or structural integrity

  • Structure-based design strategies:

    • Homology modeling based on structurally characterized plsY proteins from other bacterial species

    • Virtual screening campaigns targeting the substrate binding pockets

    • Fragment-based drug discovery approaches focusing on high-efficiency binding to key motifs

    • Structure-activity relationship development guided by the three-dimensional arrangement of conserved residues

  • Leveraging species-specific features:

    • Comparison of plsY sequences across bacterial species to identify S. haemolyticus-specific residues near the active site

    • Targeting the unique membrane topology of S. haemolyticus plsY, particularly the five membrane-spanning segments and cytoplasmic domains

    • Exploiting potential differences in substrate specificity between S. haemolyticus plsY and human glycerol-3-phosphate acyltransferases

  • Rational inhibitor design approaches:

    • Development of acylphosphate mimetics that compete with the natural substrate

    • Design of transition state analogs based on the catalytic mechanism

    • Creation of covalent inhibitors targeting conserved nucleophilic residues

    • Allosteric inhibitors that disrupt the essential conformational changes during catalysis

  • Methodological considerations:

    • Use of membrane mimetics (nanodiscs, lipid bilayers) for structural studies of this integral membrane protein

    • Application of computational techniques like molecular dynamics simulations to model membrane-embedded plsY

    • Integration of biophysical methods (HDX-MS, NMR) to map inhibitor binding sites

By focusing on these structure-based approaches, researchers can develop inhibitors with high specificity for bacterial plsY over mammalian glycerol-3-phosphate acyltransferases, potentially creating new antimicrobial agents effective against multidrug-resistant S. haemolyticus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.