Recombinant Staphylococcus haemolyticus Glycosyl-4,4'-diaponeurosporenoate acyltransferase (crtO)

Shipped with Ice Packs
In Stock

Description

Introduction

Staphylococcus haemolyticus Glycosyl-4,4'-diaponeurosporenoate acyltransferase, commonly referred to as CrtO, is an enzyme involved in the biosynthesis of staphyloxanthin, a carotenoid pigment found in Staphylococcus aureus and related staphylococci . Staphyloxanthin contributes to the virulence of S. aureus by providing protection against reactive oxygen species and contributing to the bacterium's golden color . CrtO is an acyltransferase that catalyzes a late-stage step in staphyloxanthin biosynthesis .

Function and Mechanism

CrtO functions as an acyltransferase, specifically esterifying glucose at the C6'' position with the carboxyl group of 12-methyltetradecanoic acid . This reaction is the final step in the synthesis of staphyloxanthin .

The biosynthesis of staphyloxanthin involves several enzymes, including :

  • CrtM (dehydrosqualene synthase): Catalyzes the formation of dehydrosqualene from farnesyl diphosphate.

  • CrtN (dehydrosqualene desaturase): Converts dehydrosqualene into 4,4'-diaponeurosporene.

  • CrtP (mixed function oxidase): Oxidizes 4,4'-diaponeurosporene to form 4,4'-diaponeurosporenic acid.

  • CrtQ (glycosyltransferase): Esterifies glucose at the C1'' position of 4,4'-diaponeurosporenic acid to produce glycosyl-4,4'-diaponeurosporenoate.

  • CrtO (acyltransferase): Esterifies glucose at the C6'' position with the carboxyl group of 12-methyltetradecanoic acid to yield staphyloxanthin .

Genetic Context

The genes encoding staphyloxanthin biosynthesis enzymes, including crtO, are typically organized in an operon . In Staphylococcus aureus, this operon is designated as crtOPQMN . The expression of this operon is regulated, in part, by the sigma(B) transcription factor .

Role in Staphylococcus haemolyticus

S. haemolyticus is a coagulase-negative staphylococcus species commonly found on human skin . While S. aureus is better known for its virulence, S. haemolyticus is also recognized as an opportunistic pathogen, particularly in hospital settings . Genes obtained via horizontal gene transfer might contribute to the bacterium's adaptation and evolution in response to antibiotic usage in hospitals .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crtO; SH0487; Glycosyl-4,4'-diaponeurosporenoate acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-171
Protein Length
Full Length of Mature Protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
crtO
Target Protein Sequence
NMMLRCPTSVFVKYETFFKIWSWEKRGALWNKLFRINKWKHYIPEAAQFNYRIYNKRRLA SFKLEDIHFMILEMRRAELVHWLSMIPIVIFIKAPKYILFINVCYVISAKLPIILTQRYN RPRLEHYYQLRMKRDERTCRKRKSSL
Uniprot No.

Target Background

Function

This enzyme catalyzes the acylation of glycosyl-4,4'-diaponeurosporenoate, specifically the esterification of glucose at the C6'' position with the carboxyl group of the C(15) fatty acid 12-methyltetradecanoic acid. This reaction yields staphyloxanthin, the final step in the biosynthesis of this orange pigment found in most staphylococcal strains.

Database Links

KEGG: sha:SH0487

STRING: 279808.SH0487

Protein Families
Acyltransferase CrtO family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the biological function of Glycosyl-4,4'-diaponeurosporenoate acyltransferase (crtO) in Staphylococcus haemolyticus?

Glycosyl-4,4'-diaponeurosporenoate acyltransferase (crtO) is an enzyme that catalyzes the acylation of glycosyl-4,4'-diaponeurosporenoate with fatty acids (typically 12-methyltetradecanoic acid) to form staphyloxanthin or staphyloxanthin-like pigments in Staphylococcus species. In S. haemolyticus, this enzyme is part of the carotenoid biosynthetic pathway that produces pigments contributing to bacterial virulence and survival mechanisms.

The acylation reaction catalyzed by crtO can be represented as:

Glycosyl-4,4'-diaponeurosporenoate + 12-Methyltetradecanoyl-CoA → Staphyloxanthin + CoA

This reaction enhances membrane localization of the pigment and significantly contributes to bacterial antioxidant defense mechanisms. To study crtO function, researchers typically use gene knockout approaches followed by LC-MS analysis to detect characteristic loss of the fatty acid-glucose residue in the resulting metabolites.

How does the biosynthetic pathway of carotenoid pigments in S. haemolyticus compare to other Staphylococcus species?

The carotenoid biosynthetic pathway in S. haemolyticus shares significant similarities with other Staphylococcus species, particularly S. aureus, but with some distinct characteristics. The pathway involves a series of enzymatic steps encoded by the crt operon:

  • CrtM: Condenses farnesyl diphosphate into dehydrosqualene (4,4'-diapophytoene)

  • CrtN: Desaturates dehydrosqualene to 4,4'-diaponeurosporene

  • CrtP: Oxidizes 4,4'-diaponeurosporene to form 4,4'-diaponeurosporenic acid

  • CrtQ: Glycosylates 4,4'-diaponeurosporenic acid, forming glycosyl-4,4'-diaponeurosporenoate

  • CrtO: Adds a fatty acid to produce the final carotenoid pigment

Molecular analysis demonstrates that S. haemolyticus shares significant genetic similarity with other staphylococci. For instance, the mecA gene responsible for methicillin resistance in S. haemolyticus shows 99.95% similarity to its counterparts in S. aureus and S. epidermidis, suggesting potential interspecies transfer of genetic elements . This high degree of similarity likely extends to the crt operon genes, including crtO.

To investigate these similarities experimentally, researchers typically perform comparative genomic analyses, gene expression studies, and biochemical characterization of the recombinant enzymes from different species.

What analytical methods are used to identify and quantify crtO enzyme activity in bacterial samples?

The activity of recombinant crtO enzyme can be measured using several complementary analytical approaches:

  • HPLC-MS Analysis: High-performance liquid chromatography coupled with mass spectrometry allows the detection of substrate (glycosyl-4,4'-diaponeurosporenoate) depletion and product (staphyloxanthin) formation. Key diagnostic ions include the molecular ion [M+H]+ and characteristic fragmentation patterns showing loss of glycosyl or acyl groups.

  • UV-Vis Spectroscopy: Spectrophotometric methods can track changes in absorption maxima (λmax) as the reaction progresses. The substrate glycosyl-4,4'-diaponeurosporenoate has characteristic absorption maxima at 460 nm and 483 nm, while the acylated product staphyloxanthin exhibits maxima at 463 nm and 490 nm.

  • Enzyme Kinetics Assays: In vitro reconstitution of enzyme activity using purified recombinant crtO, the substrate, and acyl-CoA donors allows determination of kinetic parameters such as Km and Vmax values.

For accurate quantification, calibration curves using purified standards are essential, and normalization to bacterial biomass (measured as OD600) is recommended to account for culture variability.

What expression systems are most effective for producing recombinant S. haemolyticus crtO?

For recombinant expression of S. haemolyticus crtO, several expression systems have been employed with varying degrees of success:

  • E. coli Expression Systems: The most commonly used host for initial characterization, typically employing BL21(DE3) strains with pET-series vectors for IPTG-inducible expression. While this system offers high protein yields, the membrane-associated nature of crtO may lead to inclusion body formation, necessitating optimization of induction conditions (temperature, IPTG concentration) and potential refolding strategies.

  • Gram-positive Hosts: Expression in B. subtilis or related Staphylococcus species that lack endogenous carotenoid pathways may provide a more native-like environment for proper folding and activity.

  • Cell-free Expression Systems: These can be advantageous for membrane-associated enzymes like crtO, allowing direct incorporation into artificial membrane systems.

When purifying recombinant crtO, researchers must consider its membrane association. Standard purification protocols typically include:

  • Cell lysis using sonication or French press

  • Membrane solubilization with detergents (e.g., DDM, CHAPS)

  • Affinity chromatography (His-tag purification)

  • Size exclusion chromatography for further purification

The choice of detergent is critical for maintaining enzyme activity, with milder detergents generally preferred for functional studies.

How do mutations in the crtO gene affect pigment production and antimicrobial resistance in S. haemolyticus?

Mutations in the crtO gene significantly impact carotenoid pigment production and, consequently, antimicrobial resistance in S. haemolyticus. Specific effects include:

  • Alterations in Pigment Profile: Loss-of-function mutations in crtO result in accumulation of the precursor glycosyl-4,4'-diaponeurosporenoate and absence of fully acylated carotenoids. This can be observed through changes in colony pigmentation and confirmed by LC-MS analysis of extracted pigments.

  • Increased Susceptibility to Oxidative Stress: Since the final acylated carotenoid products contribute to membrane stability and antioxidant defense, crtO mutants typically show increased sensitivity to hydrogen peroxide, neutrophil-mediated killing, and other oxidative stressors.

  • Altered Membrane Properties: The absence of acylated carotenoids affects membrane fluidity and rigidity, potentially influencing susceptibility to membrane-targeting antimicrobials.

  • Reduced Virulence: In infection models, crtO mutants often display attenuated virulence due to increased susceptibility to host immune defenses.

S. haemolyticus is notably more resistant to antibiotics than other coagulase-negative staphylococci, with the widest spectrum of resistance observed in hospital-isolated strains . The relationship between carotenoid pigmentation and this extensive multidrug resistance phenotype represents an important area for investigation, as crtO mutations may influence the expression or function of resistance determinants.

What mechanisms regulate the expression of crtO in multidrug-resistant clinical isolates of S. haemolyticus?

The regulation of crtO expression in multidrug-resistant S. haemolyticus isolates involves complex regulatory networks that respond to environmental stressors. Advanced research approaches to investigate these mechanisms include:

  • Transcriptomic Analysis: RNA-seq analysis of S. haemolyticus under different stress conditions (oxidative stress, antibiotic exposure, temperature variation) reveals differential expression patterns of the crt operon genes, including crtO. This approach has identified potential transcriptional regulators that coordinate pigment production with stress responses.

  • Chromatin Immunoprecipitation (ChIP-seq): This technique can identify direct binding of regulatory proteins to the crtO promoter region, elucidating transcriptional control mechanisms.

  • Reporter Gene Assays: Construction of promoter-reporter fusions (luciferase or fluorescent proteins) allows quantitative assessment of crtO expression under different conditions.

S. haemolyticus isolates from hospital environments show notably higher antibiotic resistance than community-acquired strains . The correlation between crtO expression levels and multidrug resistance phenotypes can be investigated through comparative analysis of clinical isolates.

In many multidrug-resistant isolates, the presence of resistance genes correlates with transcriptional changes in virulence factors, including the crt operon. Studies have identified that genes mediating resistance to β-lactams (blaZ), quinolones (norA), and macrolides/lincosamides/streptogramins (msr(A)) may be co-regulated with virulence determinants like crtO . This suggests that antibiotic pressure may inadvertently select for increased expression of virulence-associated genes.

How does the structural biology of S. haemolyticus crtO inform its substrate specificity and catalytic mechanism?

Advanced structural biology approaches provide critical insights into crtO function:

  • Homology Modeling and Molecular Dynamics: In the absence of crystal structures, homology models based on related acyltransferases can predict the three-dimensional structure of crtO. Molecular dynamics simulations further refine these models and predict substrate binding modes.

  • Site-Directed Mutagenesis: Targeted mutation of predicted catalytic residues (typically serine, histidine, and aspartate forming a catalytic triad) followed by kinetic characterization identifies residues essential for activity.

  • Substrate Analog Studies: Testing a range of acyl-CoA donors with different chain lengths and modifications reveals substrate preferences and constraints.

The catalytic mechanism of crtO likely follows a ping-pong bi-bi mechanism typical of acyltransferases:

  • Binding of acyl-CoA donor

  • Formation of acyl-enzyme intermediate

  • Release of CoA

  • Binding of glycosyl-4,4'-diaponeurosporenoate

  • Transfer of acyl group to acceptor

  • Release of acylated product

Key structural features that determine substrate specificity include:

  • A hydrophobic binding pocket accommodating the acyl chain

  • A binding site for the carotenoid substrate

  • Catalytic residues positioned to facilitate acyl transfer

Advanced biophysical techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes during catalysis, providing insights into the reaction mechanism.

How can researchers resolve discrepancies in reported enzymatic properties of recombinant crtO from different S. haemolyticus strains?

Researchers investigating discrepancies in reported enzymatic properties of recombinant crtO from different S. haemolyticus strains should implement the following methodological approaches:

  • Standardized Expression and Purification Protocols:

    • Use identical expression systems, tags, and purification methods

    • Verify protein integrity by SDS-PAGE, western blotting, and mass spectrometry

    • Implement quality control measures including circular dichroism to confirm proper folding

  • Comprehensive Sequence Analysis:

    • Perform phylogenetic analysis of crtO sequences from different strains

    • Identify naturally occurring polymorphisms that might explain functional differences

    • Use directed evolution approaches to correlate sequence variations with altered enzyme properties

  • Standardized Activity Assays:

    • Control for buffer composition, pH, temperature, and substrate concentrations

    • Use internal standards and reference enzymes for normalization

    • Employ multiple complementary assay methods (spectrophotometric, HPLC, radiometric)

  • Environmental Factors Consideration:

    • S. haemolyticus strains from different clinical settings may show adaptations in crtO function

    • Investigate strain-specific post-translational modifications

    • Examine effects of cultivation conditions on enzyme properties

ParameterPotential Sources of DiscrepancyMitigation Strategy
Kinetic parameters (Km, Vmax)Variations in assay conditions, substrate qualityStandardize assay conditions, use high-purity substrates
Substrate specificityStrain-specific adaptations, assay sensitivityTest multiple substrates, use sensitive detection methods
Temperature/pH optimaBuffer systems, stabilizing additivesUse consistent buffer systems, determine pH-rate profiles
Inhibition patternsContaminants, allosteric effectorsEnsure enzyme purity, test for potential regulators

By systematically addressing these factors, researchers can determine whether observed differences represent genuine strain-specific adaptations or experimental artifacts.

What role does crtO play in biofilm formation and persistence of S. haemolyticus in hospital environments?

The role of crtO in biofilm formation and persistence of S. haemolyticus in hospital environments represents a critical area of investigation:

  • Biofilm Formation Assays:

    • Compare wild-type and crtO-deficient strains for biofilm formation using crystal violet staining

    • Employ confocal microscopy with fluorescent stains to analyze biofilm architecture

    • Use flow cell systems to study biofilm development under dynamic conditions

  • Gene Expression Analysis:

    • Perform RNA-seq comparing planktonic and biofilm growth states

    • Use RT-qPCR to measure crtO expression levels during different phases of biofilm formation

    • Employ transcriptional reporter constructs to visualize crtO expression patterns within biofilm structures

  • Resistance Mechanisms in Biofilms:

    • Test antimicrobial susceptibility in biofilm vs. planktonic states

    • Investigate the contribution of carotenoid pigments to biofilm matrix stability

    • Examine biofilm tolerance to disinfectants and antiseptics

S. haemolyticus is highly prevalent in hospital environments, with research showing that qac genes can confer resistance to antiseptics and can be horizontally transferred among bacteria . The potential relationship between crtO activity, carotenoid production, and antiseptic resistance in biofilms is particularly relevant for infection control strategies.

Experimental data from biofilm models indicate that:

  • Carotenoid pigments contribute to extracellular polymeric substance (EPS) hydrophobicity

  • pigmented S. haemolyticus biofilms show enhanced resistance to desiccation

  • Acylated carotenoids may interact with other matrix components to enhance structural integrity

These findings suggest that crtO inhibition could represent a novel strategy for biofilm control in healthcare settings.

How can CRISPR-Cas systems be optimized for investigating crtO function in clinical isolates of S. haemolyticus?

CRISPR-Cas systems offer powerful tools for genetic manipulation of S. haemolyticus to investigate crtO function:

  • CRISPR-Cas9 System Optimization:

    • Adapt delivery methods for efficient transformation of clinical isolates

    • Design S. haemolyticus-specific promoters for Cas9 and sgRNA expression

    • Optimize PAM sequences for maximum editing efficiency

    • Develop non-integrative plasmid systems with temperature-sensitive origins

  • CRISPR Interference (CRISPRi) Applications:

    • Utilize catalytically inactive Cas9 (dCas9) for targeted gene repression

    • Design sgRNAs targeting different regions of the crtO gene to achieve varying degrees of knockdown

    • Implement inducible CRISPRi systems for temporal control of crtO expression

    • Combine with RNA-seq to profile downstream metabolic shifts

  • Gene Replacement Strategies:

    • Design homology-directed repair templates with selectable markers

    • Create point mutations to study specific catalytic residues

    • Generate domain swaps between crtO genes from different Staphylococcus species

    • Introduce reporter tags for protein localization studies

  • Multiplexed Genetic Analysis:

    • Simultaneously target multiple genes in the carotenoid biosynthetic pathway

    • Create combinatorial mutant libraries to study pathway interactions

    • Implement CRISPR array systems for sequential gene editing

CRISPR ApplicationTechnical ConsiderationsExpected Outcomes
Complete gene knockoutPAM site availability, potential polar effectsLoss of acylated carotenoids, accumulation of precursors
Domain-specific mutationsHDR efficiency, screening methodsStructure-function insights, altered substrate specificity
Promoter modificationsOff-target effects, expression stabilityUnderstanding of transcriptional regulation
CRISPRisgRNA design, repression efficiencyDose-dependent phenotypes, temporal regulation

Successful implementation of these CRISPR-based approaches requires optimization for the specific characteristics of S. haemolyticus, including its restriction-modification systems and transformation protocols.

How does the horizontal transfer of crtO and associated genes contribute to the evolution of virulence in S. haemolyticus?

Investigating horizontal gene transfer (HGT) of crtO and associated carotenoid biosynthesis genes provides insights into the evolution of virulence in S. haemolyticus:

  • Comparative Genomic Analysis:

    • Analyze whole-genome sequences of diverse S. haemolyticus isolates

    • Identify genomic islands and mobile genetic elements associated with crt genes

    • Examine GC content, codon usage bias, and other signatures of HGT

    • Compare crtO sequences across staphylococcal species to trace evolutionary history

  • Transfer Mechanisms Investigation:

    • Study potential roles of plasmids, bacteriophages, and transposons

    • Examine association with other transferable elements like SCCmec cassettes

    • Investigate the role of the ccr gene complex in mobilizing crt genes

  • Experimental Evolution Studies:

    • Subject S. haemolyticus to selective pressures that might favor acquisition of crt genes

    • Monitor co-transfer of resistance and virulence determinants

    • Track changes in carotenoid production following experimental gene transfer

Molecular analysis demonstrates that the S. haemolyticus genome contains the ccr gene complex, which enables the combination of resistance cassettes like mecA with chromosomal DNA . This same mechanism may facilitate the transfer of virulence-associated genes, including crtO. The remarkably high similarity (99.95%) between the mecA genes of S. aureus, S. haemolyticus, and S. epidermidis strongly supports the hypothesis of interspecies gene transfer . Similar patterns may exist for crtO and other carotenoid biosynthesis genes.

Interestingly, research has shown that S. haemolyticus readily acquires antimicrobial resistance genes and shares, to some extent, a common gene pool with S. epidermidis . This genetic exchange network likely extends to virulence factors like carotenoid biosynthesis genes.

What methodologies are most effective for high-throughput screening of crtO inhibitors as potential antimicrobial agents?

Developing high-throughput screening (HTS) methodologies for crtO inhibitors requires sophisticated approaches:

  • Enzyme-Based Screening Assays:

    • Develop colorimetric or fluorometric assays detecting either CoA release or product formation

    • Implement coupled enzyme assays linking crtO activity to detectable signals

    • Optimize reaction conditions for stability and reproducibility in 384 or 1536-well formats

    • Establish Z-factor calculations to ensure assay robustness

  • Whole-Cell Phenotypic Screens:

    • Develop reporter strains with pigment-dependent readouts

    • Implement image-based analysis of colony pigmentation

    • Create growth conditions that maximize pigment production for clearer signal windows

    • Design counter-screens to eliminate compounds with general growth inhibitory effects

  • Target-Based Virtual Screening:

    • Generate homology models of S. haemolyticus crtO

    • Perform molecular docking of virtual compound libraries

    • Implement pharmacophore-based screening approaches

    • Use machine learning algorithms to predict potential inhibitors based on structural features

  • Fragment-Based Approaches:

    • Screen fragment libraries using thermal shift assays or NMR

    • Develop hit expansion strategies for promising fragments

    • Utilize structure-guided approaches to optimize fragment hits

Screening MethodAdvantagesLimitationsValidation Approach
Enzyme-based assaysDirect measurement of inhibition, mechanistic insightsRequires purified protein, potential artifactsDose-response curves, mode of inhibition studies
Whole-cell phenotypicIdentifies cell-penetrant molecules, accounts for metabolismLess specific, multiple targets possibleSecondary enzyme assays, resistant mutant generation
Virtual screeningCost-effective, large libraries searchableDepends on model quality, false positivesExperimental validation of top hits, structure-activity relationships
Fragment screeningIdentifies efficient binders, optimization potentialWeak initial binding, complex optimizationFragment growing, linking, or merging strategies

The most promising inhibitors identified through these screens should be evaluated for their effects on biofilm formation, virulence in infection models, and potential for resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.