Recombinant Staphylococcus haemolyticus Heme A synthase (ctaA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify this in your order; we will prioritize fulfilling this request.
Synonyms
ctaA; SH1837; Heme A synthase; HAS; Cytochrome aa3-controlling protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
ctaA
Target Protein Sequence
MFNKRNLKWLSVLATIIMAFVQLGGALVTKTGSEDGCGSSWPLCHGALLPQNLPIDTIIE LSHRAVSGLSLIVVLWLAITAWKHIGYIREVKPLAIISIAFLLVQALIGAAAVIWQQNSY VLALHFGISLISFSSVFVLMLIIFEVDKKYEADELYIRKPLRRLTWIMTGIVYLTIYTGA LVRHAKASLAYGGWPLPFHDIIPHTEQDWVQFAHRGMAFITFFWIMITFIHAVKNYSENR TIRYGYTTAFILIILQVITGALSVMTNVNLFIALLHALFITILFGMIAYFIMLMLRTIRS EKIK
Uniprot No.

Target Background

Function

Catalyzes the oxidation of the C8 methyl side group on the heme O porphyrin ring to a formyl group.

Database Links

KEGG: sha:SH1837

STRING: 279808.SH1837

Protein Families
COX15/CtaA family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus haemolyticus Heme A synthase (ctaA) and what is its significance in bacterial metabolism?

Staphylococcus haemolyticus Heme A synthase (ctaA) is an essential enzyme involved in the final steps of heme A biosynthesis. The protein (UniProt ID: Q4L5C9) catalyzes the conversion of heme O into heme A through an oxidative reaction. Heme A is a specialized prosthetic group crucial for cellular aerobic respiration and energy conversion across various organisms, including bacteria, plants, and animals .

The significance of ctaA in bacterial metabolism lies in its role in cytochrome assembly and respiratory chain function. Heme A serves as a cofactor in terminal oxidases, which are critical for energy production through oxidative phosphorylation. In staphylococcal species, the maintenance of heme homeostasis is essential for survival, especially during infection when bacteria must adapt to changing environmental conditions .

How is the ctaA gene structured in S. haemolyticus and how does it compare to other staphylococcal species?

The ctaA gene in S. haemolyticus (strain JCSC1435) is identified as locus SH1837 . The gene encodes a full-length protein of 304 amino acids, which functions as a transmembrane protein with multiple membrane-spanning domains .

When comparing S. haemolyticus ctaA to other staphylococcal species, there are notable similarities in function but differences in genetic regulation. For instance, in S. aureus, heme biosynthesis is regulated through phosphorylation and dephosphorylation mechanisms involving the serine/threonine kinase Stk1 and the phosphatase Stp1 . This post-translational regulation mechanism appears to be part of an integrated system that governs staphylococcal heme synthesis based on both heme availability and cell growth status.

What experimental approaches are most effective for studying recombinant S. haemolyticus ctaA function?

Several experimental approaches have proven effective for studying recombinant S. haemolyticus ctaA function:

Heterologous Expression Systems:

  • E. coli expression systems have been successfully used to produce recombinant ctaA protein, typically with N-terminal histidine tags to facilitate purification .

  • The use of specialized E. coli strains with enhanced membrane protein expression capabilities may improve yield and proper folding.

Functional Assays:
Based on studies of related ctaA proteins from B. subtilis and S. aureus, the following assays can be adapted for S. haemolyticus:

  • Spectroscopic Analysis: UV-visible spectroscopy to monitor heme conversion, tracking characteristic absorbance shifts between heme O (λmax ≈ 548 nm) and heme A (λmax ≈ 587 nm) .

  • HPLC Analysis: Extraction and separation of heme compounds followed by HPLC analysis to quantify conversion rates and product formation.

  • Oxygen Consumption Assays: Since heme A synthase activity is dependent on molecular oxygen, oxygen electrode measurements can assess enzyme activity .

  • Site-Directed Mutagenesis: Mutation of conserved histidine residues (as identified in B. subtilis studies) to assess their role in catalysis and heme binding .

  • Complementation Studies: Testing the ability of S. haemolyticus ctaA to complement ctaA deletion mutants in model organisms like B. subtilis or S. aureus.

Protein Purification Considerations:

  • Use of detergent micelles or nanodiscs to maintain the native conformation of the membrane protein during purification

  • Affinity chromatography followed by size exclusion chromatography to obtain pure, active enzyme

What role does ctaA play in S. haemolyticus virulence and persistence?

The role of ctaA in S. haemolyticus virulence and persistence can be inferred from studies of related staphylococcal species and the general importance of heme biosynthesis in bacterial pathogenesis:

Connection to Virulence:

  • Energy Production: As a key enzyme in heme A biosynthesis, ctaA is essential for cytochrome assembly and respiratory chain function, directly impacting energy production necessary for virulence factor expression .

  • Adaptation to Host Environment: During infection, S. haemolyticus must control heme levels to replicate and survive within the hostile host environment, similar to mechanisms described in S. aureus .

  • Stress Response: Proper heme biosynthesis contributes to bacterial resistance against oxidative stress encountered during host immune responses.

Role in Persistence:
Studies in S. aureus have shown that heme biosynthesis deficiency affects persister formation . Persisters are subpopulations of bacteria that can survive antibiotic treatment and contribute to chronic infections.

Table: Impact of Heme Biosynthesis on S. aureus Persistence Under Different Stresses

Stress ConditionWild-type Persister LevelΔhemA Persister LevelLog Reductionp-value
Acid stressReferenceDecreased~1.59-log<0.001
Oxidative stressReferenceDecreased~1.83-log<0.001
Ciprofloxacin (400 mg/ml, 7 days)ReferenceDecreased~1.83-log<0.001

This data from S. aureus studies suggests that functional heme biosynthesis pathways are critical for bacterial persistence under various stress conditions, a finding likely relevant to S. haemolyticus.

Given that S. haemolyticus is frequently associated with bloodstream and medical device-related infections , the ability to persist in these environments may be linked to proper heme metabolism and ctaA function.

How can structural analysis of ctaA inform drug development strategies?

Structural analysis of ctaA provides valuable insights for drug development strategies against S. haemolyticus and other staphylococcal pathogens:

Target Validation:
The essentiality of heme A for bacterial respiration makes ctaA an attractive target. Studies in S. aureus have validated that targeting heme biosynthesis enzymes can inhibit bacterial growth .

Structural Considerations for Drug Design:

  • Active Site Targeting: Identification of the catalytic site where heme O binds can guide the design of competitive inhibitors.

  • Transition State Mimics: Understanding the catalytic mechanism of ctaA, which involves oxidative reactions, can inform the development of transition state analogs as potent inhibitors.

  • Allosteric Inhibition: Mapping allosteric sites that affect protein conformational changes required for catalysis may reveal opportunities for non-competitive inhibition.

Comparative Analysis with S. aureus:
Studies with S. aureus have shown that:

  • Analogues of acifluorfen can inhibit the flavin-containing HemY enzyme in the heme biosynthetic pathway

  • The transitional pathway for heme biosynthesis found in many Gram-positive pathogenic bacteria represents a unique target that differs from the human host pathway

Advantages of ctaA as a Drug Target:

  • Pathway Divergence: The bacterial heme biosynthesis pathway differs from the human pathway, offering selectivity for antimicrobial development.

  • Membrane Localization: As a membrane-bound protein, ctaA has domains accessible from the extracellular space, potentially facilitating drug access without requiring cellular penetration.

  • Limited Resistance Mechanisms: The essential nature of the enzyme and the constraints on its function may limit the development of resistance mutations that maintain enzyme activity.

What are the optimal conditions for expressing and purifying functional recombinant S. haemolyticus ctaA?

Based on available data for staphylococcal membrane proteins and specific information for S. haemolyticus ctaA , the following represent optimal conditions for expression and purification:

Expression System Optimization:

  • Host Selection: E. coli BL21(DE3) or C41(DE3)/C43(DE3) strains specifically engineered for membrane protein expression are recommended.

  • Vector Design:

    • Inclusion of an N-terminal 10xHis tag as documented for existing recombinant preparations

    • Codon optimization for E. coli expression

    • Consideration of fusion partners (e.g., MBP) that can enhance solubility while maintaining function

  • Expression Conditions:

    • Induction at lower temperatures (16-20°C) to slow protein production and aid proper folding

    • Use of lower IPTG concentrations (0.1-0.5 mM) for induction

    • Extended expression time (overnight) at reduced temperatures

    • Supplementation with δ-aminolevulinic acid and iron to support heme biosynthesis in the expression host

Purification Strategy:

  • Membrane Extraction:

    • Gentle cell lysis using lysozyme treatment followed by sonication

    • Membrane fraction isolation via ultracentrifugation

    • Solubilization using mild detergents (e.g., DDM, LMNG, or digitonin) that maintain protein structure and activity

  • Chromatographic Purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography for further purification and removal of aggregates

    • Optional ion exchange chromatography for removal of specific contaminants

  • Quality Control:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • UV-visible spectroscopy to assess heme content

    • Circular dichroism to evaluate secondary structure integrity

    • Activity assays to confirm functional state

Storage Conditions:
The recombinant protein is best stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided.

How can experimental design be optimized for studying the interaction between ctaA and potential inhibitors?

Optimizing experimental design for studying ctaA-inhibitor interactions requires careful consideration of multiple factors:

1. High-Throughput Screening (HTS) Development:

The development of a robust HTS assay for ctaA should incorporate:

  • Spectrophotometric assays monitoring heme A formation from heme O

  • Fluorescence-based assays detecting changes in protein conformation upon inhibitor binding

  • Thermal shift assays to identify compounds that affect protein stability

2. Structure-Activity Relationship (SAR) Studies:

SAR studies should be designed with the following considerations:

  • Systematic modification of known inhibitors (e.g., acifluorfen analogs that inhibit HemY in S. aureus)

  • Focus on pharmacophore features that interact with conserved active site residues

  • Iterative optimization cycles with feedback from biochemical and structural studies

3. Binding Kinetics Analysis:

Methods for detailed binding kinetics should include:

  • Surface plasmon resonance (SPR) to determine association and dissociation rates

  • Isothermal titration calorimetry (ITC) for thermodynamic characterization

  • Microscale thermophoresis (MST) as an alternative for membrane proteins

4. Computational Approaches:

Integrate computational methods:

  • Homology modeling based on related bacterial ctaA structures

  • Molecular docking to predict binding modes

  • Molecular dynamics simulations to understand conformational changes upon inhibitor binding

5. Validation in Cellular Systems:

Experimental design should include validation steps:

  • Minimum inhibitory concentration (MIC) determination in S. haemolyticus cultures

  • Time-kill assays to evaluate bactericidal vs. bacteriostatic effects

  • Combination studies with existing antibiotics to identify synergistic effects

6. Target Engagement Studies:

Confirm on-target activity through:

  • Cellular thermal shift assays (CETSA) to verify inhibitor binding to ctaA in intact cells

  • Metabolomics profiling to detect changes in heme A levels and related metabolites

  • Genetic approaches (e.g., ctaA overexpression) to confirm mechanism of action

Experimental Design Considerations:

When designing experiments to evaluate ctaA inhibitors, researchers should follow the principles outlined by Lewis in "Experimental Design" (2020) , which emphasizes:

  • Controlled variation to isolate causal effects

  • Randomization to distribute variables evenly

  • Addressing potential confounding factors that could affect interpretation of results

  • Ensuring both internal validity (accurate causality assessment) and external validity (applicability to real-world scenarios)

What methods can be used to investigate the role of ctaA in bacterial persister formation?

Investigation of ctaA's role in persister formation requires a multi-faceted approach that builds on methodologies established in S. aureus research :

1. Genetic Manipulation Strategies:

Creation of Knockout Mutants:

  • Allelic replacement techniques to generate ΔctaA mutants in S. haemolyticus

  • Complementation with wild-type and mutant variants to confirm phenotypes

  • Construction of conditional knockdown strains using inducible promoters for essential genes

Gene Expression Systems:

  • Overexpression constructs using plasmids with appropriate promoters for S. haemolyticus

  • Creation of reporter fusions (e.g., ctaA-GFP) to monitor expression patterns

2. Persister Assays:

Stress-Induced Persister Formation:

  • Acid stress challenge (pH 4.0) with viable counting over time

  • Oxidative stress using hydrogen peroxide exposure

  • Antibiotic stress with suprainhibitory concentrations of ciprofloxacin or other antibiotics

Quantification Methods:

  • Time-kill curves with CFU counting

  • LIVE/DEAD staining with flow cytometry analysis

  • Single-cell analysis using microfluidics to track individual bacterial responses

3. Metabolic Analysis:

Heme Quantification:

  • HPLC analysis of cellular heme content

  • Mass spectrometry to identify heme intermediates

  • Spectrophotometric assays to monitor heme levels

Respiratory Activity:

  • Oxygen consumption measurements

  • ATP production assays

  • Membrane potential analysis using fluorescent probes

4. Transcriptomic and Proteomic Approaches:

Differential Expression Analysis:

  • RNA-seq to identify genes affected by ctaA deletion/inhibition

  • Quantitative proteomics to assess changes in protein levels

  • ChIP-seq for regulatory networks involving ctaA

Pathway Analysis:
Based on S. aureus studies , focus on pathways likely affected by ctaA manipulation:

  • Energy metabolism

  • Amino acid metabolism

  • Carbohydrate metabolism

  • Membrane transport systems

5. Infection Models:

In Vitro Models:

  • Biofilm formation assays

  • Adherence to medical device materials

  • Co-culture with host cells

In Vivo Models:

  • Implant-associated infection models

  • Systemic infection models with monitoring of bacterial persistence

Methodological Implementation:
Following the approach used in S. aureus studies , researchers should implement a systematic workflow:

  • Generate and characterize ctaA mutants

  • Perform persister assays under various stress conditions

  • Conduct transcriptomic analysis to identify affected pathways

  • Validate key findings through targeted gene manipulation

  • Test phenotypic restoration through complementation or metabolite supplementation

How can researchers investigate potential synergistic effects between ctaA inhibitors and conventional antibiotics?

Investigating synergistic effects between ctaA inhibitors and conventional antibiotics requires systematic methodologies:

1. In Vitro Synergy Testing:

Checkerboard Assays:

  • Perform two-dimensional dilution matrices of ctaA inhibitor and antibiotic

  • Calculate Fractional Inhibitory Concentration Index (FICI) values

  • Interpret results using standard definitions: FICI ≤0.5 (synergy), >0.5-4.0 (no interaction), >4.0 (antagonism)

Time-Kill Kinetics:

  • Monitor bacterial killing over time with single agents and combinations

  • Analyze for enhanced killing rate or extended post-antibiotic effect

  • Define synergy as ≥2 log10 reduction in CFU/mL with the combination compared to the most active single agent

2. Mechanism Studies:

Biochemical Pathway Analysis:

  • Investigate effects on heme biosynthesis pathway intermediates

  • Monitor respiratory chain activity with combinations

  • Assess membrane potential and cellular energy status

Resistance Development:

  • Serial passage experiments with sub-inhibitory concentrations

  • Determination of mutation frequencies under selection pressure

  • Whole genome sequencing to identify resistance mechanisms

3. Advanced Cellular Assays:

Biofilm Testing:

  • Minimum biofilm eradication concentration (MBEC) determination

  • Confocal microscopy with LIVE/DEAD staining to visualize penetration effects

  • Crystal violet assays to quantify biofilm biomass reduction

Persister Cell Targeting:

  • Persister formation assays with drug combinations

  • Recovery monitoring after drug removal

  • Single-cell analysis of heterogeneous populations

4. Experimental Design Considerations:

Optimization Approach:

  • Response surface methodology to identify optimal concentration ratios

  • Factorial design to assess effects of environmental factors (pH, oxygen, nutrients)

  • Analysis of variance (ANOVA) to determine statistical significance

Technical Replicates:

  • Minimum of three biological replicates per condition

  • Control for inoculum effect by standardizing starting bacterial concentrations

  • Include appropriate positive and negative controls

5. Advanced Models:

Ex Vivo Systems:

  • Human serum/whole blood assays to account for protein binding

  • Simulated endocardial vegetation models

  • Hollow fiber infection models for pharmacodynamic studies

In Vivo Models:

  • Animal infection models with combination therapy

  • Pharmacokinetic/pharmacodynamic (PK/PD) parameter determination

  • Tissue distribution and target engagement assessment

Analytical Framework:
Researchers should apply a systematic framework that progresses from:

  • Initial screening for synergy using standard methods

  • Detailed mechanistic investigation of promising combinations

  • Evaluation in complex biological systems

  • Identification of optimal dosing strategies and potential clinical applications

This approach aligns with principles of controlled experimentation while providing clinically relevant insights into combination therapy potential.

What analytical methods are most appropriate for characterizing the catalytic mechanism of S. haemolyticus ctaA?

Characterizing the catalytic mechanism of S. haemolyticus ctaA requires sophisticated analytical methods that can interrogate enzyme function at molecular detail:

1. Spectroscopic Techniques:

UV-Visible Spectroscopy:

  • Time-resolved spectral changes during catalysis

  • Difference spectra to identify intermediates

  • Stopped-flow kinetics to capture transient species

Resonance Raman Spectroscopy:

  • Identification of key vibrational modes of heme moieties

  • Detection of Fe-O2 interactions during catalysis

  • Characterization of substrate-enzyme complexes

Electron Paramagnetic Resonance (EPR):

  • Determination of heme iron oxidation and spin states

  • Identification of radical intermediates

  • Analysis of structural changes upon substrate binding

2. Structural Analysis:

X-ray Crystallography:

  • Structure determination of ctaA in various states (substrate-free, substrate-bound, product-bound)

  • Identification of key active site residues

  • Visualization of conformational changes during catalysis

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Mapping protein dynamics during catalysis

  • Identification of regions with altered solvent accessibility

  • Detection of allosteric networks within the protein

Cryo-Electron Microscopy:

  • Structure determination of membrane-embedded enzyme

  • Visualization of enzyme in native lipid environment

  • Analysis of oligomeric states and interaction partners

3. Mechanistic Enzymology:

Steady-State Kinetics:

  • Determination of kinetic parameters (KM, kcat, kcat/KM)

  • Inhibition studies to probe binding modes

  • pH and temperature dependence of activity

Pre-Steady-State Kinetics:

  • Rapid kinetics to identify reaction intermediates

  • Burst phase analysis to determine rate-limiting steps

  • Single-turnover experiments to isolate individual reaction steps

Isotope Effects:

  • Kinetic isotope effects using deuterated substrates

  • Heavy-atom isotope effects to probe transition states

  • Solvent isotope effects to identify proton transfer steps

4. Computational Approaches:

Quantum Mechanics/Molecular Mechanics (QM/MM):

  • Modeling of reaction mechanisms at electronic level

  • Calculation of activation energies for competing pathways

  • Prediction of transition state structures

Molecular Dynamics Simulations:

  • Analysis of protein dynamics during catalysis

  • Investigation of substrate access channels

  • Prediction of water molecules involved in catalysis

5. Site-Directed Mutagenesis Studies:

Based on the approach used in B. subtilis CtaA studies , targeted mutagenesis should focus on:

  • Conserved histidine residues that may coordinate heme

  • Residues predicted to interact with substrates

  • Amino acids involved in proton transfer networks

Experimental Implementation Strategy:

A comprehensive characterization would proceed through these stages:

  • Initial structural characterization and homology modeling

  • Identification of key catalytic residues through conservation analysis

  • Preparation of site-directed mutants and kinetic characterization

  • Spectroscopic analysis of wild-type and mutant enzymes

  • Integration of experimental data with computational models

  • Proposal and validation of detailed catalytic mechanism

This multi-technique approach would provide insights into how S. haemolyticus ctaA performs the oxidative conversion of heme O to heme A, which could inform both basic understanding of heme metabolism and applied aspects of antimicrobial development.

What are the most promising future research directions for S. haemolyticus ctaA studies?

The study of S. haemolyticus ctaA presents several promising research directions that could advance both fundamental understanding of bacterial metabolism and practical applications in antimicrobial development:

1. Structural Biology Advancements:

  • Determination of high-resolution structures of S. haemolyticus ctaA in different conformational states

  • Comparative analysis with ctaA homologs from other pathogenic bacteria

  • Structure-guided design of selective inhibitors targeting unique features of the protein

2. Systems Biology Integration:

  • Comprehensive understanding of ctaA's role in the broader context of S. haemolyticus metabolism

  • Network analysis of interactions between heme biosynthesis and other cellular processes

  • Identification of synthetic lethal interactions that could be exploited therapeutically

3. Host-Pathogen Interactions:

  • Investigation of how ctaA activity influences S. haemolyticus adaptation to host environments

  • Analysis of heme biosynthesis regulation during infection processes

  • Exploration of the interplay between host iron restriction and bacterial heme synthesis

4. Antimicrobial Development:

  • Design of novel ctaA inhibitors with optimized pharmacokinetic properties

  • Development of combination therapies targeting multiple steps in heme biosynthesis

  • Creation of narrow-spectrum antibiotics specific to S. haemolyticus and closely related pathogens

5. Diagnostic Applications:

  • Development of ctaA activity-based probes for rapid detection of S. haemolyticus

  • Creation of biosensors using engineered ctaA variants

  • Identification of ctaA-specific biomarkers for infection monitoring

6. Evolutionary Studies:

  • Analysis of ctaA sequence variation across clinical isolates of S. haemolyticus

  • Investigation of horizontal gene transfer events involving heme biosynthesis genes

  • Exploration of evolutionary pressures shaping ctaA function in hospital environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.