Recombinant Staphylococcus haemolyticus Heme sensor protein hssS (hssS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
hssS; SH0696; Heme sensor protein HssS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
hssS
Target Protein Sequence
MFKTLYTRIAIYTITVILFSALVSFLFANVYYHFNLKAHNDAKIMRTLKEARAFHTSSNQ SDTQSYFKHLGDMNYQIMIVDHSYHKTFFGEPFRKDTISDSAINQVLKGKAYHGIKNKPF ELFITGFFDNETDNTVGIPFNQNNQKLAVFMRPDIGETFSEFRTFLAVLLICLLGISITL VIASTYSIIKPIKILKQATERLMHGDFNSPIYQSRHDEIGTLQYRFEAMRQSLKQVDDMR QHFVQNVSHEIKTPLTHIHRLLSTLQSNVNQGERDQIIHEIHEEVTHLSNLTKELLLLSE LDNATHLKFEDDVHFKELITDIIRHEQYGIDNKQLMLMSDIDTVHFRGNNRLLHQACSNL IQNAIKYSNPNSMIDVNLFNNEGTIYFTVTNEGHTIPESVQPHLFDRFYKRNAEDNSNGL GLAITQSIIHLHRGQISVTSNDRDGTTFTVTLPETN
Uniprot No.

Target Background

Function

Recombinant Staphylococcus haemolyticus Heme sensor protein hssS (hssS) is a member of the two-component regulatory system HssS/HssR, crucial for intracellular heme homeostasis and modulating staphylococcal virulence. HssS acts as a heme-sensing histidine kinase, undergoing autophosphorylation at a histidine residue before transferring the phosphate group to an aspartate residue on HssR. The HssR/HssS complex subsequently activates expression of hrtAB, an efflux pump, in response to extracellular heme, hemin, hemoglobin, or blood.

Database Links

KEGG: sha:SH0696

STRING: 279808.SH0696

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus haemolyticus and what is its clinical significance?

Staphylococcus haemolyticus is one of the most common pathogens associated with medical-device related infections. It represents a skin commensal that has gained increased attention as an emerging pathogen of nosocomial infections . The species shows remarkable adaptability to hospital environments, primarily through acquisition of multi-drug resistance determinants and other pathogenicity traits. Phylogenetic studies have identified a single highly prevalent genetic lineage, clonal complex (CC) 29, accounting for approximately 91% of nosocomial isolates disseminated worldwide . This species demonstrates significant genomic plasticity, with recombination playing a major role in shaping its population structure and contributing to its pathogenic potential .

What is the HssS protein and what is its molecular function?

The HssS protein functions as a membrane-bound histidine kinase that forms part of a two-component heme sensing system (HssRS). This system counteracts environmental heme toxicity by triggering expression of the efflux transporter HrtBA . Structurally, HssS is characterized as a membrane-bound homodimer containing an extracellular sensor domain and a cytoplasmic conserved catalytic domain . The protein belongs to the HisKA-type histidine kinase family and plays a crucial role in bacterial adaptation to heme toxicity in host environments. The sensing mechanism involves direct interaction of exogenous heme with HssS at the membrane/extracellular interface, initiating HssS activation and inducing HrtBA-mediated heme efflux .

How is the HssS protein structurally organized?

The HssS protein exhibits a complex structural organization with distinct functional domains. The extracellular domain (ECD) displays a mixed α/β-fold with a PDC (PhoQ-DcuS-CitA)-like structure topology . The central structure consists of a 4-stranded antiparallel β-sheet flanked by α-helices on either side: a long N-terminal α-helix and a short C-terminal α-helix that both lie on the same side of the sheet . The transmembrane organization includes two transmembrane helices: TM helix α1 (residues 11-31) that extends to initiate the long N-terminal helix participating in the mixed α/β fold of the PDC domain, and a second TM helix (helix α4) . This structural arrangement facilitates the protein's function in heme sensing and signal transduction.

What is the molecular mechanism of HssS activation by heme?

The activation of HssS by heme occurs through a direct ligand sensing mechanism at the membrane level. Structural simulation studies using Alphafold2, followed by heme docking, have revealed a heme-binding site present in the HssS dimer at the interface between the membrane and extracellular domains . In this model, heme is embedded in the membrane bilayer with its two protruding porphyrin propionates interacting with two conserved arginine residues (Arg94 and Arg163) that are located extracellularly .

The interaction involves a single-conserved hydrophobic structural domain (per monomer) with the two conserved anchoring arginines at the membrane-extracellular interface. This arrangement accommodates heme and initiates signal transduction . Targeted mutagenesis studies have identified pivotal residues required for HssS sensing function and heme binding, supporting this model of direct ligand sensing at the membrane level . The process represents a novel paradigm for two-component system activation, where membrane heme control of HssS combined with membrane heme extrusion by HrtB constitutes a defense system when bacteria are exposed to lysed erythrocytes or other heme-rich environments .

How does recombination influence S. haemolyticus population structure and evolution?

Recombination serves as a principal evolutionary driver in S. haemolyticus, having a higher impact than mutation in shaping the population structure . Analysis of sequence changes at multilocus sequence typing (MLST) loci during clonal diversification demonstrates that recombination events contribute significantly to genetic diversity . This recombination-driven evolution likely represents a strategic adaptation mechanism that facilitates the species' pathogenicity and environmental adaptation .

Furthermore, horizontal gene transfer (HGT) appears to be a driving force in S. haemolyticus evolution, particularly in response to the selective pressure of broad-spectrum antibiotics used in hospitals . The pan-genomic analysis of S. haemolyticus reveals a relatively stable core genome comparable to other staphylococcal species, but with a steeper pan-genome accumulation curve than observed in S. epidermidis and S. aureus . This indicates a greater rate of accessory genome acquisition, much of which is likely mediated through recombination and horizontal transfer events.

What role do insertion sequence (IS) elements play in S. haemolyticus adaptation?

Insertion sequence (IS) elements, particularly IS1272, contribute significantly to clonal diversification and adaptation in S. haemolyticus . All nosocomial S. haemolyticus isolates studied, regardless of sequence type, show enrichment in IS1272 copies as determined by Southern hybridization of macrorestriction patterns . Experimental evidence demonstrates that the chromosome of S. haemolyticus strains within CC29 is highly unstable during serial growth in vitro, with changes paralleling IS1272 transposition events and alterations in clinically relevant phenotypic traits .

These IS elements likely facilitate the acquisition and integration of mobile genetic elements containing adaptive traits, such as antibiotic resistance genes. The transposition events contribute to genome plasticity, allowing for rapid adaptation to selective pressures encountered in hospital environments. This mechanism appears to be particularly important for nosocomial adaptation and may explain the successful establishment of specific S. haemolyticus lineages in healthcare settings .

What genetic markers distinguish clinical from commensal S. haemolyticus isolates?

Several genetic signatures clearly differentiate clinical from commensal S. haemolyticus isolates. Comparative genomic analysis reveals that clinical isolates commonly contain:

  • A homolog of the serine-rich repeat glycoprotein sraP, which may contribute to adhesion and virulence

  • Novel capsular polysaccharide operons with potential roles in virulence

  • Genetic determinants for multi-drug resistance, present in 88% of clinical isolates compared to only 11% of commensal isolates

  • Genes associated with biofilm formation capacity

  • Specific resistance markers, including mecA (oxacillin resistance) and aacA-aphD (aminoglycoside resistance)

The presence of these genetic markers provides a predictive framework for distinguishing invasive from commensal isolates. Specifically, biofilm-forming S. haemolyticus isolates that exhibit resistance to oxacillin and aminoglycosides are most likely invasive isolates, whereas the absence of these traits strongly indicates a commensal isolate .

How can researchers express and purify recombinant S. haemolyticus HssS protein?

For expression and purification of recombinant S. haemolyticus HssS protein, researchers should consider the following methodological approach:

  • Gene Cloning: Amplify the hssS gene from S. haemolyticus genomic DNA using PCR with specific primers designed based on available sequence data. The amplified gene can be cloned into an appropriate expression vector (e.g., pET series for E. coli expression) with a fusion tag (His6, GST, or MBP) to facilitate purification.

  • Expression System Selection: Choose an appropriate expression system, considering that HssS is a membrane protein. Options include:

    • E. coli expression systems with specialized strains designed for membrane protein expression (C41, C43, or Lemo21)

    • Cell-free expression systems that can handle membrane proteins

    • Insect cell or mammalian cell expression systems for more complex folding requirements

  • Optimization of Expression Conditions: Test various conditions including:

    • Induction temperature (typically lower temperatures of 16-25°C for membrane proteins)

    • Inducer concentration

    • Duration of expression

    • Media composition (consider supplementation with heme precursors or heme itself)

  • Membrane Protein Extraction: Extract using detergent solubilization methods with:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin

    • Step-gradient centrifugation for membrane fraction isolation

    • Careful optimization of detergent concentration to maintain protein structure

  • Purification Strategy: Implement multi-step purification protocols:

    • Affinity chromatography using the fusion tag

    • Size exclusion chromatography for removing aggregates

    • Ion exchange chromatography for further purification

    • Consider amphipols or nanodiscs for stabilizing the purified protein

  • Confirmation of Functionality: Verify the functional state of the purified protein through:

    • Heme binding assays

    • Autophosphorylation activity assays

    • Circular dichroism to confirm secondary structure integrity

This methodological approach requires careful optimization at each step to maintain the native structure and function of the HssS protein.

What techniques are most effective for studying HssS-heme interactions?

Several complementary techniques can be employed to study HssS-heme interactions effectively:

  • Spectroscopic Methods:

    • UV-visible spectroscopy to detect spectral shifts upon heme binding

    • Resonance Raman spectroscopy to characterize the heme-protein interactions and heme coordination state

    • Circular dichroism to detect conformational changes upon heme binding

  • Binding Kinetics and Thermodynamics:

    • Isothermal titration calorimetry (ITC) to determine binding affinity, stoichiometry, and thermodynamic parameters

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Microscale thermophoresis for binding studies with minimal protein consumption

  • Structural Biology Approaches:

    • X-ray crystallography of the HssS sensor domain in complex with heme

    • Cryo-electron microscopy for structure determination of the full-length protein

    • NMR spectroscopy for dynamic analysis of heme-induced conformational changes

  • Computational Methods:

    • Molecular docking as demonstrated with Alphafold2 models

    • Molecular dynamics simulations to study the dynamics of heme binding

    • Quantum mechanical calculations for detailed electronic interactions

  • Mutagenesis Studies:

    • Site-directed mutagenesis of predicted heme-binding residues (particularly the conserved arginines Arg94 and Arg163)

    • Construction of chimeric proteins to define binding domains

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

  • Functional Assays:

    • Phosphorylation assays to measure kinase activity in response to heme binding

    • Gene reporter assays to monitor HrtBA expression in response to HssS activation

    • Electrophoretic mobility shift assays to study phosphorylation-dependent DNA binding of the response regulator

These methods should be used in combination to build a comprehensive understanding of the HssS-heme interaction mechanisms.

How does S. haemolyticus HssS compare to heme sensing systems in other staphylococcal species?

The HssS protein and heme sensing system in S. haemolyticus shares functional similarities with those found in other staphylococcal species, particularly S. aureus. Based on the available research, we can make the following comparisons:

What are the key unresolved questions in S. haemolyticus HssS research?

Despite significant advances in understanding S. haemolyticus and its heme sensing system, several important questions remain unresolved:

  • Species-Specific Function: How does the function of HssS in S. haemolyticus specifically differ from that in other staphylococcal species, and how do these differences relate to the unique pathogenic characteristics of S. haemolyticus?

  • Structural Dynamics: What are the precise conformational changes that occur in HssS upon heme binding, and how do these changes propagate the signal to the kinase domain?

  • Regulatory Networks: How does the HssRS system integrate with other regulatory networks in S. haemolyticus, particularly those involved in virulence and antibiotic resistance?

  • Therapeutic Targeting: Can the HssS protein be effectively targeted for therapeutic intervention to reduce S. haemolyticus pathogenicity, and what would be the most effective approach?

  • Host Factors: How do host factors influence HssS function, and are there host-specific adaptations of the HssS system in S. haemolyticus?

  • Evolution: How has the HssS protein evolved in S. haemolyticus compared to other staphylococcal species, and what selective pressures have shaped this evolution?

Addressing these questions will require a combination of structural biology, molecular genetics, biochemistry, and systems biology approaches.

Comparison of Key Characteristics Between Clinical and Commensal S. haemolyticus Isolates

CharacteristicClinical IsolatesCommensal IsolatesStatistical Significance
Multi-drug resistance108/123 (88%)5/46 (11%)p < 0.05
Presence of serine-rich repeat glycoprotein (sraP) homologCommonRareSignificant
Novel capsular polysaccharide operonsPresentOften absentSignificant
Biofilm formation capabilityHighLowSignificant
Oxacillin resistance (mecA)CommonRareSignificant
Aminoglycoside resistance (aacA-aphD)CommonRareSignificant
IS1272 copiesEnrichedLimitedSignificant

Data compiled from comparative genomic analysis studies .

Structural Features of the HssS Protein Critical for Heme Sensing

Structural FeatureFunctionConservation
Extracellular domain with PDC-like topologyLigand sensingConserved across staphylococcal species
4-stranded antiparallel β-sheet flanked by α-helicesStructural scaffoldHighly conserved
Arg94 residueInteraction with heme propionateConserved in staphylococcal HssS proteins
Arg163 residueInteraction with heme propionateConserved in staphylococcal HssS proteins
Hydrophobic structural domain at membrane-extracellular interfaceHeme accommodationConserved
TM helix α1 (residues 11-31)Membrane anchoring and signal transductionConserved
TM helix α4Membrane anchoring and signal transductionConserved

Data derived from structural simulation and functional studies of HssS .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.