Recombinant Staphylococcus haemolyticus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SH1560; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVTYIIMPLIGKIFGSVDFAKDWEFWG IKYGLFIQSIIDFIIVAIALFIFVKIANTLVKKEEPEEEIEENTVLLTEIRDLLRAK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: sha:SH1560

STRING: 279808.SH1560

Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus haemolyticus and why is it clinically significant?

Staphylococcus haemolyticus is a key species of the Staphylococcus genus that holds significant importance in healthcare-associated infections. As a coagulase-negative bacterium, it poses a substantial challenge in the battle against nosocomial infections due to its notable resistance to antimicrobials, particularly methicillin, and its proficient biofilm-forming capabilities . Recent genomic research has revealed the considerable genetic plasticity of S. haemolyticus, which contributes to the widespread dissemination of antibiotic resistance elements within the genus .

S. haemolyticus is one of the most common pathogens associated with medical-device related infections, with a single highly prevalent genetic lineage (clonal complex 29) accounting for approximately 91% of clinical isolates worldwide . The molecular basis of S. haemolyticus pathogenicity likely involves putative hemolysins, adhesins, exonucleases, proteases, and genes encoding capsular polysaccharides, though these mechanisms remain less well characterized than those of other staphylococcal species .

What are large-conductance mechanosensitive channels (mscL) and how do they function in bacteria?

Mechanosensitive channels in bacterial membranes function as molecular gates that open or close in response to environmental changes, allowing for controlled transmembrane transport of various substances, including antibiotics and solutes . The large-conductance mechanosensitive channel (mscL) represents a specific type of these channels that responds to membrane tension.

In staphylococci, mscL channels operate at higher critical adhesion forces compared to their smaller counterparts (mscS). Research has demonstrated that mscL channels respond to mechanical stress induced by adhesion forces when bacteria attach to surfaces . These channels play crucial roles in bacterial adaptation to environmental changes, particularly osmotic shifts, by facilitating the controlled release or uptake of solutes to maintain cellular integrity.

While most research on bacterial mscL has been conducted in organisms like Escherichia coli and S. aureus, the fundamental principles likely apply to S. haemolyticus as well, with potential species-specific variations in channel properties and regulation.

What methods are commonly used to clone and express recombinant S. haemolyticus mscL?

Based on established protocols for other staphylococcal species, the following methodological approach is recommended for cloning and expressing recombinant S. haemolyticus mscL:

  • Gene identification and isolation: Use comparative genomics to identify the mscL gene sequence in S. haemolyticus. PCR amplification with specific primers designed based on conserved regions can be used to isolate the gene.

  • Vector selection: Select an appropriate expression vector compatible with either E. coli or staphylococcal expression systems, depending on experimental goals. For structural studies, vectors with affinity tags (His6, GST) are preferable.

  • Transformation and selection: Transform the recombinant construct into the host organism and select transformants using appropriate antibiotics.

  • Expression optimization: Optimize expression conditions including temperature, induction time, and inducer concentration to maximize protein yield while maintaining proper folding.

  • Purification strategy: Implement a multi-step purification protocol typically involving affinity chromatography followed by size exclusion chromatography to obtain pure, functional protein.

When working with S. haemolyticus, researchers should account for the genomic plasticity and presence of insertion sequences that may impact gene stability during cloning procedures .

How can researchers verify the functionality of recombinant mscL channels?

Functional verification of recombinant mscL channels can be accomplished through several complementary approaches:

  • Fluorescent dye uptake assays: Monitor the uptake of fluorescent molecules such as calcein in response to osmotic downshock or adhesion forces. Functional channels will allow dye entry when activated, resulting in increased fluorescence .

  • Patch-clamp electrophysiology: Directly measure channel conductance in reconstituted liposomes or spheroplasts to characterize channel opening, conductance properties, and gating kinetics.

  • Antibiotic susceptibility testing: Assess the role of mscL in antibiotic uptake by comparing susceptibility between wild-type bacteria and those expressing recombinant mscL channels. For example, the uptake of dihydrostreptomycin can be monitored through bacterial killing assays .

  • Complementation studies: Restore mscL function in knockout mutants by introducing the recombinant mscL gene, then verify restoration of wild-type phenotypes under osmotic stress conditions.

How does adhesion force affect mscL gating in staphylococcal species?

Research has established a significant relationship between bacterial adhesion forces and mechanosensitive channel gating in staphylococci. When S. aureus adheres to surfaces with increasing force, there is a corresponding increase in membrane tension that triggers mscL channel opening, which can be experimentally observed through increased transmembrane transport .

The relationship between adhesion force and channel activation follows a strain-specific threshold pattern:

StrainAdhesion Force ThresholdCalcein UptakeDihydrostreptomycin CFU Reduction
Wild-type>4.0 nN66% fluorescent2.3 log-units (at >3.5 nN)
ΔmscL mutant>1.2 nN40% fluorescent1.0 log-units (force-independent)

These findings suggest that mscL channels open at a higher critical adhesion force compared to mscS channels, contributing to a staged response to mechanical stress . The data supports the hypothesis that adhesion forces to surfaces play an important role in staphylococcal channel gating, complementing other established driving forces.

This mechanism provides an interesting extension of our understanding of transmembrane antibiotic uptake and solute efflux in infectious staphylococcal biofilms, where bacteria experience adhesion forces from various surfaces including other bacteria, tissue cells, and implanted biomaterials .

What genetic mechanisms influence mscL expression and function in S. haemolyticus?

The expression and function of mscL in S. haemolyticus are likely influenced by several genetic mechanisms:

  • Insertion sequence elements: S. haemolyticus isolates from hospital environments are rich in IS1272 copies, which can cause genomic rearrangements and affect gene expression . During in vitro serial growth, IS1272 transposition events correlate with changes in clinically relevant phenotypic traits, potentially including membrane protein expression .

  • Recombination: Recombination has been shown to have a higher impact than mutation in shaping the S. haemolyticus population structure . This genetic exchange may affect the mscL gene sequence and potentially its expression regulation.

  • Clonal complex affiliation: The predominant hospital-associated lineage, CC29, may have specific regulatory patterns affecting membrane protein expression, including mscL channels .

  • Methicillin resistance elements: The presence of SCCmec elements carrying the mecA gene, which confers methicillin resistance, may indirectly affect membrane composition and channel function through alterations in cell wall synthesis .

These genetic mechanisms contribute to the adaptability of S. haemolyticus in hospital environments and may explain phenotypic variations observed in clinical isolates, potentially including differences in mscL expression and function.

What experimental designs are most appropriate for studying recombinant S. haemolyticus mscL function?

When designing experiments to study recombinant S. haemolyticus mscL function, researchers should consider several statistical design approaches to control for variability and isolate treatment effects:

  • Randomized Block Design: This approach is particularly valuable when studying mscL function across different bacterial strains or conditions while controlling for batch effects. For example:

    Block (Bacterial Batch)Treatment 1 (Strain A)Treatment 2 (Strain B)Treatment 3 (Strain C)
    Batch 1ResponseResponseResponse
    Batch 2ResponseResponseResponse
    Batch 3ResponseResponseResponse

    Analysis of this design using ANOVA can separate treatment effects from block effects, with F-statistics used to test significance .

  • Latin Square Design: When three sources of variation need to be controlled (e.g., bacterial strain, growth medium, and temperature), a Latin square arrangement can efficiently test treatment effects while blocking in two directions .

  • Graeco-Latin Square Design: For more complex experiments with four sources of variation (e.g., adding test assembly as another factor), this design allows blocking in three directions while maintaining a manageable number of experimental runs .

  • Balanced Incomplete Block Design: When resource constraints prevent testing all treatments within each block (e.g., limited batch size), this design maintains statistical balance while allowing for incomplete blocks .

The choice of design should be guided by the specific research question, the number of factors being investigated, and the resources available. For all designs, researchers should perform model adequacy checking, including analysis of normality, independence of errors, and homoscedasticity .

How can researchers address data contradictions in mscL functional studies?

When confronted with contradictory data in mscL functional studies, researchers should implement a systematic approach to resolution:

What challenges exist in structural characterization of recombinant S. haemolyticus mscL?

Structural characterization of recombinant S. haemolyticus mscL presents several technical challenges:

  • Membrane protein expression and purification:

    • Optimization of detergent selection for membrane extraction without compromising protein structure

    • Maintaining protein stability during purification steps

    • Achieving sufficient yield for structural analysis techniques

  • Genomic instability considerations:

    • S. haemolyticus exhibits high chromosomal instability during serial growth, which parallels with IS1272 transposition events

    • This instability could lead to sequence variations in the expressed protein, complicating structural studies that require homogeneous samples

  • Functional state capture:

    • mscL channels exist in different conformational states (closed, intermediate, open)

    • Capturing specific states for structural analysis requires precise control of membrane tension or use of mutants that favor particular conformations

  • Species-specific structural features:

    • While mscL channels are conserved across bacterial species, S. haemolyticus may possess unique structural elements that affect channel function in response to its environmental niche

    • These species-specific features may only be apparent when the protein is studied in its native lipid environment

  • Reconciling structure with phenotypic variations:

    • The frequent phenotypic variation observed in S. haemolyticus may reflect structural polymorphisms in membrane proteins

    • Correlating structural data with functional outcomes requires careful selection of representative strains

How does recombination influence the genetic diversity of mscL genes in clinical S. haemolyticus isolates?

Examination of sequence changes during clonal diversification in S. haemolyticus has revealed that recombination has a higher impact than mutation in shaping the population structure . This finding has significant implications for mscL genetic diversity in clinical isolates:

  • Homologous recombination: Analysis of multilocus sequence typing (MLST) data shows evidence of frequent recombination events within the predominant hospital-associated clonal complex (CC29), which accounts for 91% of clinical isolates . These events likely affect numerous genes, potentially including mscL.

  • Gene transfer and acquisition: S. haemolyticus strains exhibit substantial genomic plasticity, facilitating the acquisition of genetic elements that may alter membrane composition and function. This plasticity could introduce novel mscL variants or regulatory elements affecting channel expression.

  • Selective pressure in hospital environments: The hospital environment exerts selective pressures that favor specific genetic variants. For mscL, this could select for variants that optimize bacterial survival under the osmotic challenges present in clinical settings or in the presence of certain antibiotics.

  • Correlation with phenotypic traits: Recombination events in S. haemolyticus correlate with changes in clinically relevant phenotypic traits including mannitol fermentation, susceptibility to beta-lactams, biofilm formation, and hemolysis . These phenotypic changes may be linked to alterations in membrane properties and channel function.

The high prevalence of recombination in nosocomial S. haemolyticus suggests that mscL genetic diversity should be carefully considered when designing experiments with recombinant channels, as different clinical isolates may harbor functionally distinct channel variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.