Recombinant Staphylococcus haemolyticus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Molecular Function of LspA

LspA is an aspartyl protease responsible for cleaving the signal peptide of prolipoproteins after the conserved lipobox motif (e.g., -Leu-Ala/Ser-Gly-Cys-). This cleavage is essential for lipid anchoring of lipoproteins to the bacterial membrane . In S. aureus, LspA activity is linked to:

  • Survival in human blood during infection .

  • Resistance to host innate immune defenses .

  • Cell envelope stability and biofilm formation .

Structural studies of S. aureus LspA (LspMrs) reveal:

  • A four-transmembrane helix bundle with catalytic aspartates (Asp118 and Asp136) .

  • A substrate-binding pocket inhibited by antibiotics like globomycin and myxovirescin .

Enzymatic Properties and Assays

While recombinant S. haemolyticus LspA has not been explicitly studied, methods for homologous enzymes (e.g., S. aureus LspA) include:

Table 1: Key Biochemical Properties of S. aureus LspA

PropertyValue/Description
Protein length163 amino acids
TagN-terminal hexahistidine
Expression systemEscherichia coli
Activity assayFRET-based lipopeptide cleavage
InhibitorsGlobomycin, myxovirescin A1
Structural resolution1.92 Å (LspMrs-globomycin complex)

Activity is measured via:

  • Gel-shift assays using modified prolipoprotein substrates .

  • Fluorescence resonance energy transfer (FRET) with synthetic lipopeptides .

Antibiotic Targeting and Drug Development

LspA is a promising target for novel antibiotics due to its role in virulence. Key findings include:

  • Globomycin binds the substrate pocket, blocking catalytic aspartates .

  • Myxovirescin inhibits LspA through a distinct binding site, suggesting opportunities for combination therapies .

  • Structural overlaps between inhibitors provide a blueprint for broad-spectrum drug design .

Genomic and Pathogenicity Insights in S. haemolyticus

Although lspA in S. haemolyticus remains uncharacterized, genomic studies highlight:

  • High prevalence of antibiotic resistance genes (mecA, aacA-aphD) linked to hospital adaptation .

  • Biofilm formation and cytotoxicity in human cell models .

  • Horizontal gene transfer of resistance elements (e.g., Tn4001 transposon) .

Research Gaps and Future Directions

  • Recombinant expression: No published protocols exist for S. haemolyticus LspA, though S. aureus LspA is produced in E. coli with a His-tag .

  • Structural studies: Comparative analysis with S. aureus LspA could reveal species-specific adaptations.

  • Therapeutic potential: Screening S. haemolyticus LspA against inhibitors like globomycin may identify novel leads.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile, deionized water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; SH1718; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
lspA
Target Protein Sequence
MKKKYYITISLIVAIAILIIDQVTKRIIATTMNIGDSYEVIPNFLNITSHRNNGAAWGIL SGKMGFFYIITIVILIVLVLFYIKEAKYNLFMQVAISLLFAGALGNFIDRLVNGEVVDFV DTNIFGYDFPIFNVADSSLTIGVLFIIIALLKDANSKE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: sha:SH1718

STRING: 279808.SH1718

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of LspA in Staphylococcus haemolyticus?

LspA (lipoprotein signal peptidase) is an aspartyl protease responsible for cleaving the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway. It plays a crucial role in the maturation of bacterial lipoproteins, which are essential for maintaining cell envelope integrity and function . While specific research on S. haemolyticus LspA is more limited, studies on the closely related S. aureus have shown that this enzyme contributes significantly to bacterial survival in host environments and virulence .

To study LspA function experimentally, researchers often employ gene deletion strategies (creating ΔlspA mutants) followed by phenotypic characterization. This includes comparing growth patterns in laboratory media, survival in human blood, and susceptibility to antimicrobial compounds between wild-type and mutant strains .

How conserved is LspA across Staphylococcus species?

LspA exhibits remarkable conservation across Staphylococcus species, making findings from one species potentially applicable to others. Analysis of over 26,000 S. aureus genomes revealed that LspA is highly sequence-conserved, with 96% of isolates showing only a single amino acid substitution that does not appear to affect function . This conservation extends to the catalytic dyad and 14 additional highly conserved residues surrounding the active site .

Methodologically, researchers can perform comparative genomic analyses to assess LspA conservation between S. haemolyticus and other Staphylococcus species. Sequence alignment tools can identify conserved domains, active sites, and potential species-specific variations. This high degree of conservation suggests that inhibitors designed against one Staphylococcal LspA might be effective across multiple species.

Why is LspA considered an attractive target for antimicrobial development?

LspA possesses several characteristics that make it an excellent target for antimicrobial development:

  • No mammalian homologs exist, reducing the risk of off-target effects

  • Its extracellular location makes it accessible to drugs

  • High sequence conservation suggests a lower likelihood of resistance development

  • LspA is essential for full virulence in Gram-positive bacteria like Staphylococci

  • Inhibition strategies represent an "antivirulence" approach with potentially minimal selective pressure

For S. haemolyticus specifically, targeting LspA could be particularly valuable in addressing infections caused by this increasingly important nosocomial pathogen, especially given its growing resistance to conventional antibiotics.

What are the optimal methods for recombinantly expressing and purifying S. haemolyticus LspA?

Successful recombinant expression of membrane proteins like LspA requires careful consideration of expression systems and purification strategies:

Expression System Selection:

  • E. coli-based expression systems (BL21(DE3), C41(DE3), or C43(DE3)) are commonly used for membrane proteins

  • Addition of an N-terminal histidine tag facilitates purification while maintaining protein function

  • Expression vectors that allow tight control of expression (like pET series) help manage potential toxicity

Optimized Expression Protocol:

  • Transform expression plasmid into selected E. coli strain

  • Culture in suitable media (e.g., Terrific Broth) at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-20°C before induction with IPTG (0.1-0.5 mM)

  • Continue expression for 16-20 hours at the reduced temperature

  • Harvest cells by centrifugation

Purification Strategy:

  • Resuspend cell pellet in buffer containing protease inhibitors

  • Disrupt cells by sonication or high-pressure homogenization

  • Isolate membrane fraction by ultracentrifugation

  • Solubilize membranes using appropriate detergents (DDM, LMNG, or similar)

  • Perform immobilized metal affinity chromatography (IMAC)

  • Further purify by size exclusion chromatography

For functional and structural studies, maintaining LspA in a native-like membrane environment is critical, which may require reconstitution into nanodiscs or liposomes after purification.

How can researchers effectively assess LspA enzymatic activity in vitro?

Measuring LspA activity requires specialized assays that account for its membrane-embedded nature and specific protease function:

Fluorogenic Peptide Substrate Assay:

  • Design peptide substrates that mimic the natural cleavage site with fluorophore-quencher pairs

  • Upon cleavage by LspA, the fluorophore separates from the quencher, generating measurable fluorescence

  • Monitor reaction kinetics in real-time using a fluorescence plate reader

  • Calculate enzyme activity based on fluorescence increase rates

Mass Spectrometry-Based Assay:

  • Incubate purified LspA with synthetic lipoprotein signal peptide substrates

  • Terminate reactions at defined time points

  • Analyze reaction products by LC-MS/MS to identify and quantify cleaved peptides

  • Determine kinetic parameters based on product formation over time

Controls and Validation:

  • Include catalytically inactive LspA mutants (e.g., mutations in the catalytic dyad) as negative controls

  • Test with known inhibitors (globomycin or myxovirescin) to confirm specificity

  • Vary substrate concentrations to determine Michaelis-Menten kinetic parameters

What molecular dynamics techniques are most appropriate for studying LspA conformational changes?

LspA undergoes significant conformational dynamics that are essential for its function. Based on recent research, the following molecular dynamics approaches are recommended :

All-Atom Molecular Dynamics Simulations:

  • Embed the protein in a lipid bilayer that mimics bacterial membrane composition

  • Include explicit solvent and physiological ion concentrations

  • Run simulations on the microsecond timescale to capture relevant conformational changes

  • Analyze trajectories focusing on:

    • Periplasmic helix mobility

    • Active site accessibility

    • Substrate binding pocket conformations

    • Water accessibility to catalytic residues

Enhanced Sampling Techniques:

  • Umbrella sampling to determine free energy profiles of conformational transitions

  • Metadynamics to explore rare conformational events

  • Replica exchange simulations to overcome energy barriers

Validation with Experimental Data:

  • Combine MD results with electron paramagnetic resonance (EPR) spectroscopy data

  • Use site-directed spin labeling at strategic positions (particularly on the periplasmic helix)

  • Compare distances between spin labels in experiments with those predicted by simulations

This hybrid computational-experimental approach has revealed that the periplasmic helix of LspA fluctuates on the nanosecond timescale and adopts different conformations in apo versus inhibitor-bound states .

How does inhibition of LspA affect S. haemolyticus susceptibility to host defense molecules and antibiotics?

Based on studies with S. aureus and other Gram-positive bacteria, LspA inhibition creates a multifaceted vulnerability :

Mechanism of Enhanced Susceptibility:

  • Compromised lipoprotein maturation disrupts cell envelope integrity

  • Immature lipoproteins accumulate in the membrane, altering its physical properties

  • Enhanced access of antimicrobial molecules to their targets

  • Potential disruption of resistance mechanisms that depend on mature lipoproteins

Experimental Approach to Quantify Effects:

  • Generate an lspA deletion mutant or use pharmacological inhibitors (globomycin/myxovirescin)

  • Perform minimum inhibitory concentration (MIC) assays with:

    • Host defense peptides (particularly human group IIA-secreted phospholipase A₂)

    • Last-resort antibiotics like daptomycin

    • Other clinically relevant antibiotics

  • Determine fold-change in susceptibility compared to wild-type

Table 1: Expected Changes in Antimicrobial Susceptibility with LspA Inhibition

Antimicrobial AgentWild-type MIC RangeExpected Fold-Change with LspA InhibitionMechanism
hGIIA (PLA₂)0.1-1 μg/mL4-8× more susceptibleEnhanced enzymatic activity on cell membrane
Daptomycin0.5-2 μg/mL2-4× more susceptibleIncreased membrane penetration
Vancomycin1-2 μg/mL1-2× more susceptibleImproved access to peptidoglycan targets
Host AMPsVariable2-4× more susceptibleDisrupted membrane integrity

These sensitization effects have been demonstrated in multiple Gram-positive species including S. aureus, Streptococcus mutans, and Enterococcus faecalis, suggesting similar effects would likely occur in S. haemolyticus .

What structural features of LspA contribute to its interaction with inhibitors like globomycin and myxovirescin?

High-resolution crystal structures have revealed remarkable insights into LspA-inhibitor interactions :

Key Structural Features of the Binding Pocket:

  • A catalytic dyad (two aspartate residues) forms the core of the active site

  • 14 highly conserved residues surround the active site and participate in inhibitor binding

  • A flexible periplasmic helix that adopts different conformations depending on ligand binding status

  • A β-cradle structure that participates in substrate and inhibitor recognition

Convergent Evolution of Inhibitor Binding:
Despite their different chemical structures, globomycin and myxovirescin bind in a strikingly similar manner:

  • They superimpose along 19 contiguous atoms that interact similarly with LspA

  • Both inhibitors mimic a tetrahedral reaction intermediate of the natural substrate

  • They approach the binding site from opposite directions but converge at the catalytic dyad

Conformational Dynamics During Binding:

  • In the apo state, the periplasmic helix predominantly adopts a closed conformation that occludes the active site

  • Upon inhibitor binding, the periplasmic helix shifts to a more open conformation

  • Multiple binding modes exist with subtle conformational differences

  • These dynamics explain how LspA accommodates diverse substrates despite high sequence conservation

Understanding these structural features provides crucial insights for designing new inhibitors targeting S. haemolyticus LspA based on the 19-atom pharmacophore identified in natural inhibitors.

How can gene knockout studies be designed to assess the role of LspA in S. haemolyticus virulence?

Based on successful approaches with S. aureus, the following methodology would be effective for S. haemolyticus :

Creation of Gene Knockout Strain:

  • Design allelic replacement construct with antibiotic resistance cassette flanked by homologous regions

  • Use temperature-sensitive plasmid system (e.g., pIMAY or pKOR1) for efficient allelic exchange

  • Confirm deletion by PCR, sequencing, and potentially Western blotting to verify protein absence

  • Complement the mutant with plasmid-borne wild-type lspA as a control

In Vitro Phenotypic Characterization:

  • Growth kinetics in standard laboratory media to assess basic fitness

  • Survival in human whole blood (comparing viable counts over time)

  • Resistance to antimicrobial peptides and antibiotics

  • Lipoprotein processing assessment by analyzing accumulation of prelipoproteins

Ex Vivo and In Vivo Virulence Models:

  • Human blood survival assay (comparing wild-type, mutant, and complemented strains)

  • Phagocytosis assays with human neutrophils

  • Mouse infection models (bacteremia, skin infection, etc.)

  • Use of transgenic mice expressing human hGIIA to better model human innate immunity

S. aureus research has shown that lspA deletion significantly reduces survival in human blood without affecting growth in plasma, indicating a specific defect in resisting phagocyte-mediated killing . Similar techniques can elucidate the role of LspA in S. haemolyticus virulence.

How might researchers develop selective inhibitors of S. haemolyticus LspA?

Developing selective inhibitors requires a structure-guided, rational drug design approach:

Structure-Based Design Strategy:

  • Obtain high-resolution structures of S. haemolyticus LspA (using X-ray crystallography or cryo-EM)

  • Compare with existing structures from other Staphylococcus species to identify unique features

  • Perform molecular docking studies using the 19-atom pharmacophore identified from globomycin and myxovirescin

  • Design compound libraries that incorporate this pharmacophore while optimizing for:

    • Improved physicochemical properties

    • Enhanced selectivity for S. haemolyticus LspA (if desired)

    • Appropriate membrane permeability

Screening and Optimization Pipeline:

  • Virtual screening of compound libraries against the S. haemolyticus LspA structure

  • Medium-throughput biochemical assays with purified recombinant enzyme

  • Bacterial killing assays to confirm whole-cell activity

  • Structure-activity relationship studies to optimize lead compounds

  • Assessment of synergy with existing antibiotics, particularly daptomycin

Potential Scaffold Approaches:

  • Simplified globomycin analogs focusing on the core pharmacophore

  • Peptidomimetic structures that retain key binding interactions

  • Non-peptidic small molecules designed to interact with the catalytic dyad

The highly conserved nature of LspA suggests that broad-spectrum inhibitors may be more feasible than highly selective ones, but species-specific features could potentially be exploited if identified.

What are the key considerations in comparing LspA from S. haemolyticus with other Staphylococcal species?

Comprehensive comparative analysis requires examination at multiple levels:

Sequence-Level Comparison:

  • Perform multiple sequence alignment of LspA proteins from various Staphylococcus species

  • Calculate sequence identity and similarity percentages

  • Identify conserved functional domains versus variable regions

  • Pay particular attention to:

    • Catalytic dyad residues

    • The 14 highly conserved residues around the active site

    • Periplasmic helix composition

    • Substrate recognition elements

Structural Comparison:

  • Generate homology models if experimental structures are unavailable

  • Superimpose structures to identify conformational differences

  • Compare electrostatic surface potentials of binding pockets

  • Analyze membrane-interacting surfaces for composition differences

Functional Comparison:

  • Develop species-specific substrate assays to assess kinetic parameters

  • Compare inhibition profiles with compounds like globomycin and myxovirescin

  • Determine if complementation across species is possible (can S. aureus LspA complement S. haemolyticus ΔlspA and vice versa?)

Understanding these similarities and differences will guide decisions about whether to pursue species-specific or broad-spectrum inhibition strategies for therapeutic development.

How can researchers investigate the potential synergistic effects between LspA inhibition and conventional antibiotics against S. haemolyticus?

Investigating synergy between LspA inhibition and conventional antibiotics requires systematic combination studies :

Experimental Design for Synergy Testing:

  • Checkerboard assays:

    • Create concentration matrices of LspA inhibitor (or use ΔlspA mutant) versus antibiotic

    • Calculate fractional inhibitory concentration (FIC) indices

    • FIC values <0.5 indicate synergy, 0.5-4 indicate additivity, >4 indicate antagonism

  • Time-kill assays:

    • Monitor bacterial killing over time with individual agents and combinations

    • Compare killing rates and extent of bacterial reduction

    • Look for enhanced bactericidal activity or prevention of regrowth

Priority Antibiotic Candidates for Testing:

  • Daptomycin (demonstrated synergy with LspA inhibition in S. aureus)

  • Other membrane-targeting antibiotics (polymyxins, lipopeptides)

  • Cell wall-active agents (β-lactams, vancomycin)

  • Host defense molecules (antimicrobial peptides, lysozyme)

Mechanistic Investigation Approaches:

  • Membrane permeability assays using fluorescent dyes

  • Lipidomic analysis to assess membrane composition changes

  • Electron microscopy to visualize cell envelope alterations

  • Transcriptomic/proteomic analysis to identify stress response pathways

These studies would determine whether LspA inhibition could serve as an adjuvant therapy to restore effectiveness of conventional antibiotics against resistant S. haemolyticus strains.

What strategies can address poor expression or insolubility of recombinant S. haemolyticus LspA?

Membrane proteins like LspA often present expression and solubility challenges that can be addressed through systematic optimization:

Expression Optimization Strategies:

  • Test multiple expression host strains (BL21(DE3), C41(DE3), C43(DE3), etc.)

  • Reduce expression temperature (16-20°C) and inducer concentration

  • Use expression vectors with tightly controlled promoters

  • Add fusion partners known to enhance membrane protein expression (MBP, SUMO, etc.)

  • Consider codon optimization for E. coli expression

Solubilization Approaches:

  • Screen multiple detergents systematically:

    • Mild detergents: DDM, LMNG, MNG-3

    • Facial amphiphiles: GDN

    • Novel solubilization agents: SMALPs, amphipols

  • Optimize detergent concentration and buffer conditions

  • Test additives that stabilize membrane proteins (cholesterol hemisuccinate, specific lipids)

Alternative Expression Systems:

  • Cell-free expression systems with supplied lipids or detergents

  • Baculovirus-insect cell expression for eukaryotic processing

  • Yeast expression systems that may better handle membrane proteins

If specific domains prove particularly challenging, consider a divide-and-conquer approach by expressing soluble domains separately from membrane-embedded regions.

How can researchers address contradictory results between in vitro and in vivo LspA inhibition studies?

Discrepancies between different experimental systems are common in LspA research and require careful investigation:

Common Sources of Contradiction:

  • Differential access of inhibitors to the target in whole cells versus purified systems

  • Compensatory mechanisms activated in vivo but absent in vitro

  • Species-specific differences in LspA function or regulation

  • Experimental artifacts from non-physiological conditions

Reconciliation Strategies:

  • Develop intermediate complexity models:

    • Spheroplast or protoplast preparations

    • Membrane vesicle systems

    • Liposome-reconstituted purified LspA

  • Use genetic and pharmacological approaches in parallel:

    • Compare lspA knockout phenotypes with inhibitor treatment effects

    • Create point mutations in catalytic residues as controls

    • Test multiple structurally distinct inhibitors

  • Employ comprehensive controls:

    • Include known inhibitor-resistant LspA mutants

    • Monitor inhibitor stability and membrane penetration

    • Account for potential off-target effects

  • Consider temporal aspects:

    • Acute versus chronic inhibition may produce different outcomes

    • Adaptation mechanisms may emerge over time in vivo

Careful documentation of experimental conditions and transparent reporting of contradictory results will advance understanding of these complex systems.

What controls are essential when studying conformational dynamics of LspA using experimental and computational methods?

Rigorous controls are essential when investigating the conformational dynamics of complex membrane proteins like LspA :

Controls for Molecular Dynamics Simulations:

  • Run multiple independent simulations with different starting conditions

  • Vary simulation parameters (force fields, water models) to ensure robustness

  • Compare results from different simulation techniques (conventional MD, enhanced sampling)

  • Validate with simplified models of key structural elements

  • Include simulations of catalytically inactive mutants as references

Controls for EPR and Other Experimental Approaches:

  • Strategic placement of spin labels at multiple sites to triangulate conformational changes

  • Use of site-directed mutants that lock specific conformations

  • Compare apo, substrate-bound, and inhibitor-bound states

  • Include detergent/lipid-only controls to account for environmental effects

  • Validate with complementary techniques (HDX-MS, FRET, etc.)

Integration of Computational and Experimental Data:

  • Use experimental data to validate computational predictions

  • Develop quantitative metrics for comparing simulation and experimental results

  • Iteratively refine models based on experimental feedback

  • Perform retrospective analysis when new structural data becomes available

This hybrid approach has successfully revealed that the periplasmic helix of LspA fluctuates between open and closed states, with implications for substrate binding and catalysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.