Recombinant Staphylococcus haemolyticus Multidrug resistance efflux pump sepA (sepA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant SepA

Recombinant Staphylococcus haemolyticus Multidrug Resistance Efflux Pump SepA (sepA) is a genetically engineered protein produced to study antibiotic resistance mechanisms in S. haemolyticus, a coagulase-negative staphylococcus (CoNS) increasingly associated with hospital-acquired infections . SepA belongs to the Small Multidrug Resistance (SMR) transporter family and is implicated in extruding antimicrobial agents, thereby reducing their intracellular concentrations and contributing to multidrug resistance (MDR) . Recombinant SepA enables functional and structural analyses to dissect its role in clinical resistance and biofilm formation .

Functional Role in Antimicrobial Resistance

SepA confers low-level resistance to:

  • Antiseptics: Benzalkonium chloride, chlorhexidine gluconate .

  • Dyes: Acriflavine, ethidium bromide .

  • Antibiotics: Contributes to fluoroquinolone and biocide resistance in S. haemolyticus clinical isolates .

Mechanism: Utilizes proton motive force to expel substrates via an H⁺:drug antiport mechanism . Its overexpression in clinical strains correlates with enhanced survival under antimicrobial pressure .

Key Studies:

  1. Genomic Analysis: Clinical S. haemolyticus isolates frequently harbor sepA alongside other resistance genes (e.g., mecA, aacA-aphD), promoting MDR phenotypes .

  2. Biofilm Association: SepA activity is linked to biofilm maturation in staphylococci, enhancing resistance in chronic infections .

  3. Comparative Genomics: sepA homologs in S. aureus and S. epidermidis share functional overlap but exhibit species-specific regulatory networks .

Data Table: SepA Across Staphylococcal Species

SpeciesGeneSubstratesRole in Resistance
S. haemolyticussepABiocides, dyes, fluoroquinolonesHospital-acquired infection adaptation
S. aureussepAAcriflavine, chlorhexidineLow-level antiseptic resistance
S. epidermidissepABenzalkonium chloride, SDSBiofilm regulation

Applications in Research

  1. Drug Resistance Studies: Used to screen efflux pump inhibitors (EPIs) targeting MDR strains .

  2. Structural Biology: Elucidate transmembrane topology and substrate-binding sites .

  3. Pathogenesis Models: Investigate SepA’s role in biofilm-mediated infections .

Challenges and Future Directions

  • Functional Variability: SepA’s substrate specificity and regulation differ across staphylococcal species, complicating broad-spectrum EPI development .

  • Clinical Validation: Limited in vivo data on S. haemolyticus SepA necessitates further studies to confirm its therapeutic target potential .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sepA; SH0873; Multidrug resistance efflux pump SepA; Antiseptic resistance protein SepA; Staphylococcal efflux pump A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
sepA
Target Protein Sequence
MKFFKNNYKNILSTLLVLTIFIISGAIFLMFLGFGLFGLSRILIFFKLGYFTYNKNLVDN LVYYGSYIVFGYFILFAIEHLMDYFRKQLPNNPYFNGSLYQLISYVVTTILFYFIIHIHY VYIEIDFWVISVIIGLLYIFKIIFYPDSENLNNKK
Uniprot No.

Target Background

Function
Involved in multidrug efflux.
Database Links

KEGG: sha:SH0873

STRING: 279808.SH0873

Protein Families
Multidrug resistance efflux pump SepA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SepA and what is its role in Staphylococcus species?

SepA (Staphylococcal efflux pump A) functions as both a metalloprotease and an efflux pump in different Staphylococcus species. In S. aureus, SepA is a chromosomally-encoded multidrug resistance (MDR) efflux pump that confers low-level resistance to antiseptic compounds, including benzalkonium chloride, chlorhexidine gluconate, and the dye acriflavine . The SepA protein in S. aureus comprises 157 amino acids with four putative transmembrane segments, characteristic of transporters from the Small Multidrug Resistance (SMR) family .

In S. epidermidis, SepA functions as a metalloprotease that plays a crucial role in biofilm formation by processing the accumulation-associated protein (Aap) . The metalloprotease SepA in S. epidermidis shares 79.3% amino acid identity with its S. aureus ortholog Aureolysin (Aur) . While S. haemolyticus SepA shares structural similarities with these homologs, species-specific variations likely exist in its function and substrate specificity.

How does SepA contribute to antimicrobial resistance?

SepA contributes to antimicrobial resistance through two primary mechanisms depending on the Staphylococcus species:

  • As an efflux pump (primarily in S. aureus and likely in S. haemolyticus): SepA actively exports antimicrobial compounds from the bacterial cell, preventing them from reaching lethal intracellular concentrations . This mechanism provides low-level resistance to antiseptic compounds and certain dyes.

  • Through biofilm formation support (primarily in S. epidermidis): SepA proteolytically processes Aap, which promotes intercellular adhesion and biofilm maturation . Biofilms provide bacteria with increased resistance to antimicrobials by creating physical barriers to antibiotic penetration and fostering altered metabolic states that reduce susceptibility.

The dual functionality of SepA across different staphylococcal species represents an important adaptive mechanism contributing to their survival under antimicrobial pressure.

How is sepA gene expression regulated in Staphylococcus species?

The regulation of sepA gene expression in Staphylococcus species involves complex regulatory networks that respond to environmental and cellular signals. Key regulatory mechanisms include:

  • SarA-mediated repression: In S. epidermidis, quantitative RT-PCR and protease activity assays have demonstrated that under standard growth conditions, sepA is repressed by the global regulator SarA . Inactivation of sarA was shown to increase sepA expression by 22.3-fold after six hours of growth and 7.8-fold after 16 hours . This suggests that SarA serves as a negative regulator of sepA expression.

  • Environmental stimuli response: Expression of efflux pump genes, including sepA, can be triggered by exposure to their substrates. Studies on S. aureus have shown that different substrates can induce expression of different efflux pump genes, and that the same substrate can promote variable responses according to its concentration .

  • Strain-specific variations: Research has demonstrated that S. aureus clinical isolates may diverge in the efflux-mediated response to antimicrobial agents, with different patterns of efflux pump gene expression observed even among highly clonally related strains .

The intricate regulatory network controlling sepA expression exemplifies how staphylococci adapt to antimicrobial pressure, with implications for developing strategies to combat antimicrobial resistance.

What methodologies are appropriate for measuring SepA activity?

Several methodologies can be employed to measure SepA activity, depending on whether its efflux pump or protease function is being investigated:

For efflux pump activity:

  • Fluorescent substrate accumulation assays: Using fluorescent substrates like ethidium bromide or acriflavine to measure intracellular accumulation in the presence and absence of efflux pump inhibitors .

  • Drug susceptibility testing with efflux inhibitors: Determining minimum inhibitory concentrations (MICs) of SepA substrates in the presence and absence of efflux pump inhibitors like reserpine or carbonyl cyanide m-chlorophenylhydrazone (CCCP) .

  • Gene expression analysis: Using quantitative RT-PCR to measure sepA expression levels under various conditions or in different genetic backgrounds .

For protease activity (as in S. epidermidis):

  • Fluorescein-labeled peptide assay: Using a specific peptide substrate that is cleaved by SepA between the Asn and Ile residues, resulting in a measurable fluorescent signal .

  • Casein zymography: A gel-based technique to detect casein-degrading proteases like SepA .

  • Biofilm formation assays: Microtiter plate assays or flow cell biofilm models to assess the impact of SepA on biofilm formation in wild-type, knockout, and complemented strains .

How do you differentiate between SepA activity and other efflux systems in experimental settings?

Differentiating SepA activity from other efflux systems requires a combination of genetic, biochemical, and pharmacological approaches:

  • Genetic approaches:

    • Construction of sepA knockout mutants and complemented strains

    • Creation of strains with multiple efflux pump gene deletions

    • Heterologous expression of sepA in a non-Staphylococcus host

  • Biochemical approaches:

    • SepA-specific activity assays (e.g., the fluorescein-labeled peptide assay for protease activity)

    • Comparison of substrate profiles between wild-type and sepA mutant strains

  • Pharmacological approaches:

    • Use of efflux pump inhibitors with varying specificities

    • Comparative analysis of resistance profiles in the presence of different inhibitors

  • Recombinant protein studies:

    • Expression and purification of recombinant SepA to conduct in vitro activity assays

    • Site-directed mutagenesis to identify critical residues for transport or protease activity

The combination of these approaches provides a comprehensive assessment of SepA's specific contribution to antimicrobial resistance or biofilm formation in the context of other cellular functions.

How can recombinant SepA be expressed and purified for in vitro studies?

Expressing and purifying recombinant SepA for in vitro studies involves several key steps:

  • Expression system selection:

    • E. coli expression systems (e.g., BL21(DE3)) with appropriate vectors (pET, pGEX) are commonly used

    • For membrane proteins like SepA, specialized strains designed for membrane protein expression may be beneficial

    • Consider codon optimization for expression in heterologous hosts

  • Fusion tag strategies:

    • N-terminal or C-terminal His6-tag for metal affinity purification

    • GST or MBP tags to enhance solubility

    • TEV or thrombin cleavage sites for tag removal post-purification

  • Membrane protein solubilization:

    • Detergent screening (DDM, LDAO, OG) to identify optimal solubilization conditions

    • Nanodiscs or liposomes for functional reconstitution

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged SepA

    • Size exclusion chromatography for further purification and buffer exchange

    • Consider ion exchange chromatography as an additional purification step

  • Functional validation:

    • In vitro efflux assays using fluorescent substrates

    • Protease activity assays for metalloprotease function

    • Thermal stability assays to optimize buffer conditions

Optimization of expression conditions (temperature, induction time, inducer concentration) is critical for obtaining sufficient quantities of functional protein. Typical yields range from 0.5-5 mg/L of bacterial culture, depending on the expression system and optimization.

What are the recommended methods for generating and validating sepA knockout mutants?

Generating and validating sepA knockout mutants requires careful experimental design and thorough validation:

  • Knockout strategy options:

    • Allelic replacement using homologous recombination

    • CRISPR-Cas9 genome editing

    • Transposon mutagenesis (less precise but useful for screening)

  • Specific protocols for Staphylococcus species:

    • Temperature-sensitive plasmids (e.g., pMAD) for allelic replacement

    • Electroporation for DNA introduction (optimization of parameters for S. haemolyticus)

    • Two-step selection process (first integration, then excision)

  • Validation methods:

    • PCR verification of gene deletion

    • Quantitative RT-PCR to confirm absence of sepA transcript

    • Whole genome sequencing to confirm clean deletion without off-target effects

    • Protease activity assays or efflux assays to confirm loss of function

    • Complementation studies to verify phenotype restoration

  • Control considerations:

    • Include wild-type controls in all experiments

    • Generate complemented mutants (sepA gene reintroduced on a plasmid)

    • Consider the impact of downstream genes and potential polar effects

  • Phenotypic characterization:

    • Antimicrobial susceptibility testing

    • Biofilm formation assays

    • Growth kinetics under different conditions

Studies with sepA mutants in S. epidermidis have shown that deletion of sepA significantly reduces biofilm formation in both microtiter plate assays and flow cell biofilm models, and that this defect can be complemented by introduction of a plasmid carrying the sepA gene .

How can the substrate specificity of SepA be comprehensively determined?

Determining the substrate specificity of SepA requires a multi-faceted approach:

  • Resistance profile analysis:

    • Minimum inhibitory concentration (MIC) determination for a wide range of compounds in wild-type vs. sepA knockout strains

    • Growth inhibition zone assays with various antimicrobial compounds

    • Time-kill kinetics with potential substrates

  • Direct transport assays:

    • Fluorescent substrate accumulation assays using potential SepA substrates

    • Radioactively labeled substrate transport studies with purified SepA in proteoliposomes

    • Competition assays between known and potential substrates

  • Binding studies:

    • Surface plasmon resonance (SPR) to measure binding of potential substrates to purified SepA

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of substrate binding

    • Fluorescence-based binding assays for high-throughput screening

  • Structural approaches:

    • Site-directed mutagenesis of predicted substrate binding sites

    • Computational docking studies of potential substrates

    • X-ray crystallography or cryo-EM of SepA in complex with substrates (if feasible)

  • Comparative analysis:

    • Cross-species comparison of SepA substrate specificity

    • Comparison with other efflux pumps in the same organism

In S. aureus, SepA has been shown to confer resistance to antiseptic compounds including benzalkonium chloride, chlorhexidine gluconate, and acriflavine . These compounds can serve as a starting point for investigating the substrate spectrum of S. haemolyticus SepA.

What is the mechanism of SepA-mediated drug efflux?

The mechanism of SepA-mediated drug efflux appears to follow the general principles of SMR family transporters, with some unique features:

  • Energy coupling:

    • SepA likely uses the proton motive force to energize drug efflux

    • Functions as an antiporter, exchanging protons (H+) for drug substrates

    • The energy coupling mechanism is similar to that of other SMR transporters

  • Substrate recognition and binding:

    • Recognizes primarily cationic, lipophilic antimicrobial compounds

    • Contains residues important for transport specificity, though positioned differently than in typical SMR proteins

    • May have a more flexible substrate binding pocket based on its broader substrate range

  • Conformational changes:

    • Likely undergoes alternating access mechanism, with conformational changes that expose the substrate binding site alternately to either side of the membrane

    • The four transmembrane segments rearrange during the transport cycle

  • Oligomerization:

    • May function as an oligomer (likely a dimer), similar to other SMR family transporters like Smr

    • Oligomerization could be essential for forming a functional transport channel

  • Regulatory aspects:

    • Activity may be modulated by membrane lipid composition

    • Potential for post-translational regulation of transport activity

The molecular details of SepA transport mechanism remain to be fully elucidated, particularly for S. haemolyticus SepA, and represent an important area for future structural and functional studies.

How does SepA interact with other resistance mechanisms in Staphylococcus species?

SepA interacts with other resistance mechanisms in Staphylococcus species through several interconnected pathways:

  • Complementary resistance mechanisms:

    • SepA provides low-level resistance that may complement higher-level resistance mechanisms like target modifications

    • Acts as a first-line defense, preventing antimicrobials from reaching lethal concentrations until more stable resistance mechanisms develop

  • Regulatory network integration:

    • SepA expression is controlled by global regulators like SarA, which also regulate other resistance and virulence factors

    • This creates coordinated responses to antimicrobial stress

  • Biofilm-associated interactions:

    • In S. epidermidis, SepA's role in Aap processing directly connects it to biofilm formation

    • Biofilms provide protection against antimicrobials through physical barriers and altered physiological states

  • Multi-efflux pump systems:

    • Studies in S. aureus show that clinical isolates often express multiple efflux pumps simultaneously

    • Different pumps may have overlapping substrate specificities, creating redundancy in efflux capacity

    • Co-regulation of multiple pumps can occur in response to antimicrobial exposure

  • Adaptive resistance development:

    • Step-wise adaptation to antimicrobials can lead to overexpression of efflux pumps, including SepA

    • This can create MDR phenotypes with resistance to multiple classes of compounds

The intricate interplay between SepA and other resistance mechanisms highlights the complexity of antimicrobial resistance in staphylococci and suggests that targeting multiple mechanisms simultaneously may be necessary for effective antimicrobial therapy.

What is the role of SepA in biofilm formation?

The role of SepA in biofilm formation has been most extensively studied in S. epidermidis, where it plays a critical function:

  • Aap processing mechanism:

    • SepA functions as a metalloprotease that cleaves the accumulation-associated protein (Aap)

    • Specifically cleaves Aap at residue 335 and between the A and B domains at residue 601

    • This proteolytic processing is essential for Aap to function as an intercellular adhesin

  • Impact on biofilm development:

    • Genetic studies have demonstrated that sepA deletion in S. epidermidis 1457Δica completely abolishes biofilm formation in microtiter plate assays

    • Flow cell biofilm models show greatly reduced biomass in sepA mutants

    • Complementation with a plasmid carrying sepA restores biofilm capacity

  • Experimental evidence:

    • Addition of purified Aureolysin (Aur), which shares 79.3% identity with SepA, enhances biofilm formation of sepA mutants

    • This provides further evidence for the specific role of SepA's protease activity in biofilm development

  • Regulatory context:

    • SepA-dependent biofilm formation is regulated by SarA, with sarA mutants showing increased SepA production and enhanced biofilm formation

  • Significance in antimicrobial resistance:

    • By promoting biofilm formation, SepA indirectly contributes to antimicrobial resistance

    • Biofilms can increase minimum inhibitory concentrations (MICs) by 10-1000 fold compared to planktonic cells

Whether S. haemolyticus SepA plays a similar role in biofilm formation remains to be fully characterized, but the conservation of this mechanism across staphylococcal species would have significant implications for treating S. haemolyticus infections.

How does SepA expression correlate with clinical antimicrobial resistance patterns?

The correlation between SepA expression and clinical antimicrobial resistance patterns is complex and multifaceted:

  • Prevalence in clinical isolates:

    • Studies on S. aureus blood isolates have shown that approximately 49% of strains exhibit increased efflux activity

    • Among strains with increased efflux activity, nearly half (48%) overexpress MDR efflux pump genes

    • Expression patterns vary between isolates, with some overexpressing single pumps and others multiple efflux pumps

  • Resistance profile associations:

    • Increased efflux activity, potentially including SepA, correlates with increased resistance to fluoroquinolones, biocides, and dyes in clinical isolates

    • The specific contribution of SepA to this resistance profile varies between strains

  • Inducible expression patterns:

    • Clinical isolates often show low baseline expression of efflux pumps but are "primed" to respond rapidly to antimicrobial exposure

    • This suggests that conventional susceptibility testing might underestimate the potential for efflux-mediated resistance

  • Evolution of resistance:

    • Step-wise adaptation studies have shown that exposure to biocides and dyes can select for MDR phenotypes through overexpression of efflux pump genes

    • This has implications for the use of antiseptics and disinfectants in healthcare settings

  • Co-selection and cross-resistance:

    • Efflux-mediated resistance to biocides may co-select for antibiotic resistance

    • This is particularly concerning for drug-resistant strains such as MRSA

Understanding the clinical significance of SepA expression requires standardized methodological approaches to detect and quantify efflux activity in clinical isolates, as well as further studies on the specific contribution of SepA to resistance phenotypes.

What approaches can be used to inhibit SepA activity for therapeutic purposes?

Several approaches can be explored to inhibit SepA activity for therapeutic purposes:

  • Direct efflux pump inhibitors:

    • Small molecule competitive inhibitors that bind to the substrate binding site

    • Allosteric inhibitors that prevent conformational changes required for transport

    • Compounds that disrupt energy coupling to the proton motive force

  • Protease inhibition strategies (for S. epidermidis SepA):

    • Metal chelators that target the metalloprotease active site

    • Substrate analog inhibitors designed based on Aap cleavage sites

    • Allosteric protease inhibitors that stabilize inactive conformations

  • Gene expression modulators:

    • Compounds that enhance SarA activity to repress sepA expression

    • RNA-based approaches (antisense oligonucleotides, RNAi) targeting sepA mRNA

    • CRISPR interference (CRISPRi) to suppress sepA transcription

  • Combination therapies:

    • Co-administration of efflux pump inhibitors with conventional antibiotics

    • Multi-target approaches addressing both SepA and other resistance mechanisms

    • Biofilm dispersion agents combined with SepA inhibitors

  • Structure-based drug design approaches:

    • Virtual screening against homology models of SepA

    • Fragment-based drug discovery targeting SepA

    • Rational design based on known substrates and inhibitors of related pumps

Experimental evaluation of potential inhibitors should include:

  • In vitro transport or protease assays with purified SepA

  • Cell-based assays measuring antimicrobial susceptibility in the presence of inhibitors

  • Biofilm inhibition assays (particularly for S. epidermidis)

  • Cytotoxicity and off-target effect assessment

How do environmental factors influence SepA expression and activity?

Environmental factors significantly influence SepA expression and activity through various mechanisms:

  • Antimicrobial exposure:

    • Exposure to SepA substrates can induce sepA expression

    • Different substrates can trigger expression to varying degrees

    • The concentration of antimicrobial agents affects the magnitude of the response

  • Growth conditions:

    • Growth phase impacts sepA expression, with different patterns observed at different time points

    • Nutrient availability may modulate expression through global regulatory networks

    • pH and ionic strength of the environment can affect both expression and transport activity

  • Regulatory influences:

    • SarA represses sepA expression under standard growth conditions

    • Environmental signals that modulate SarA activity will indirectly affect SepA levels

    • Other global regulators may respond to specific environmental cues and alter sepA expression

  • Biofilm environment:

    • The biofilm matrix creates microenvironments with altered pH, oxygen, and nutrient gradients

    • These conditions may differentially affect SepA expression compared to planktonic growth

    • SepA's role in biofilm formation creates a potential feedback loop in S. epidermidis

  • Host-associated factors:

    • Antimicrobial peptides and other host defense molecules may induce sepA expression

    • Iron limitation, often encountered during infection, may alter expression patterns

    • Temperature shifts between environmental and host temperatures may affect expression

Understanding these environmental influences is crucial for predicting SepA-mediated resistance in different clinical contexts and for designing interventions that account for these variations in expression and activity.

How does SepA compare across different Staphylococcus species?

SepA shows interesting variations across different Staphylococcus species, reflecting potential functional adaptations:

FeatureS. epidermidis SepAS. aureus SepAS. haemolyticus SepA
Primary functionMetalloproteaseEfflux pumpLikely efflux pump
SizeNot specified in sources157 amino acidsExpected similar to S. aureus
Structural featuresShares 79.3% identity with S. aureus AureolysinFour transmembrane segmentsPresumed similar to S. aureus
SubstratesAap protein (cleaves at residues 335 and 601)Antiseptics (benzalkonium chloride, chlorhexidine), dyes (acriflavine)Predicted similar to S. aureus
Role in biofilmCritical for Aap-dependent biofilm formationNot establishedNot well characterized
RegulationRepressed by SarANot specified in sourcesNot well characterized
Assay methodsFluorescein-labeled peptide assay, casein degradationAntimicrobial susceptibility testing with efflux inhibitorsNot well characterized

The apparent functional divergence between SepA in S. epidermidis (primarily a metalloprotease) and S. aureus (primarily an efflux pump) raises interesting questions about the evolution of this protein and its adaptation to different ecological niches . It remains possible that:

  • The same protein has dual functions in both species

  • The name "SepA" has been assigned to different proteins in different species

  • The protein has undergone functional specialization during species divergence

Comparative genomic and functional studies across staphylococcal species would provide valuable insights into the evolution and specialization of SepA.

What is known about the evolution of SepA and its relationship to other efflux systems?

The evolution of SepA and its relationship to other efflux systems provides insights into the development of antimicrobial resistance in staphylococci:

Further phylogenetic analyses and comparative genomics across a broader range of staphylococcal species would provide deeper insights into SepA's evolutionary history and its role in the development of antimicrobial resistance.

How can heterologous expression systems be optimized for studying S. haemolyticus SepA?

Optimizing heterologous expression systems for studying S. haemolyticus SepA requires careful consideration of several factors:

  • Expression host selection:

    • E. coli C41(DE3) or C43(DE3): Derivatives of BL21(DE3) optimized for membrane protein expression

    • Lactococcus lactis: A Gram-positive host that may provide a more native-like membrane environment

    • S. aureus RN4220: A laboratory strain amenable to genetic manipulation that provides a native staphylococcal background

  • Vector design considerations:

    • Codon optimization for the chosen expression host

    • Inducible promoter systems (e.g., T7, nisin-inducible, or tetracycline-inducible)

    • Fusion tags for detection and purification (His6, FLAG, or Strep-tag)

    • Signal sequences appropriate for membrane protein targeting

  • Expression condition optimization:

    • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    • Induction parameters: Inducer concentration and induction timing

    • Media composition: Supplementation with specific lipids or osmolytes

    • Growth phase: Typically mid-log phase for induction

  • Solubilization and purification strategies:

    • Detergent screening panel: DDM, LDAO, OG, LMNG for initial solubilization

    • Buffer optimization: pH, salt concentration, glycerol content

    • Purification method selection: IMAC, affinity chromatography, size exclusion

  • Functional reconstitution approaches:

    • Proteoliposomes: Reconstitution into artificial lipid bilayers for transport assays

    • Nanodiscs: Membrane scaffold protein-based systems for structural and functional studies

    • Whole-cell functional assays: Drug susceptibility or transport assays in the expression host

Comparative expression trials in different systems with activity assays would identify the optimal approach for obtaining functional S. haemolyticus SepA for detailed mechanistic and structural studies.

What are the key unanswered questions about SepA that require further research?

Several key questions about SepA remain unanswered and warrant further investigation:

  • Structural biology questions:

    • What is the three-dimensional structure of SepA?

    • How does the structure relate to its dual functionality as both an efflux pump and metalloprotease?

    • What are the critical residues for substrate binding and transport/catalysis?

  • Functional mechanism questions:

    • Does S. haemolyticus SepA function primarily as an efflux pump, a protease, or both?

    • What is the complete substrate profile of SepA in different Staphylococcus species?

    • How does SepA transport its substrates at the molecular level?

  • Regulatory questions:

    • What is the complete regulatory network controlling sepA expression?

    • How do environmental signals modulate SepA activity?

    • Are there post-translational modifications that affect SepA function?

  • Clinical significance questions:

    • What is the contribution of SepA to antimicrobial resistance in clinical isolates?

    • How does SepA expression correlate with treatment outcomes?

    • Is there potential for targeting SepA in antimicrobial therapy?

  • Evolutionary questions:

    • How did SepA evolve its dual functionality?

    • Why do different Staphylococcus species appear to utilize SepA for different primary functions?

    • What selective pressures have shaped SepA's structure and function?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, genetics, and clinical microbiology.

What novel techniques or approaches might advance our understanding of SepA function?

Several novel techniques and approaches could significantly advance our understanding of SepA function:

  • Advanced structural methods:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Solid-state NMR for studying SepA in a native-like membrane environment

    • Time-resolved X-ray crystallography to capture transport intermediates

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational changes during transport

    • Patch-clamp electrophysiology to measure substrate translocation in real-time

    • Force spectroscopy to investigate protein-substrate interactions

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand SepA in a cellular context

    • Network analysis of SepA interactions with other cellular components

    • Machine learning approaches to identify patterns in SepA expression and resistance phenotypes

  • Advanced genetic tools:

    • CRISPR interference for tunable gene expression control

    • Multiplexed genome editing to study SepA in combination with other resistance determinants

    • Synthetic biology approaches to engineer SepA variants with altered specificity

  • Translational approaches:

    • High-throughput screening for SepA inhibitors

    • Alternative approaches to overcome SepA-mediated resistance

    • Development of diagnostic tools to detect SepA expression in clinical settings

These advanced techniques, particularly when used in combination, would provide unprecedented insights into SepA function and potentially lead to new strategies for combating antimicrobial resistance in staphylococci.

How might research on SepA contribute to novel therapeutic strategies?

Research on SepA has significant potential to contribute to novel therapeutic strategies for combating staphylococcal infections:

  • Direct inhibition strategies:

    • Development of SepA-specific inhibitors that could be used in combination with existing antibiotics

    • Dual-action inhibitors targeting both the efflux and protease functions of SepA

    • Allosteric modulators that lock SepA in inactive conformations

  • Anti-virulence approaches:

    • In S. epidermidis, targeting SepA to prevent Aap processing and biofilm formation

    • Development of anti-biofilm agents that work by modulating SepA activity

    • Combination of SepA inhibitors with biofilm-dispersing agents

  • Diagnostic and personalized medicine applications:

    • Development of rapid diagnostic tools to detect SepA overexpression in clinical isolates

    • Use of SepA expression profiles to guide antimicrobial therapy selection

    • Monitoring of SepA expression as a biomarker for developing resistance

  • Novel antimicrobial design:

    • Structure-based design of antibiotics that evade SepA-mediated efflux

    • Development of antimicrobials that remain effective despite SepA expression

    • Trojan horse approaches that exploit SepA transport for antimicrobial delivery

  • Resistance management strategies:

    • Understanding the role of SepA in step-wise development of resistance

    • Development of protocols to prevent selection of SepA-overexpressing strains

    • Strategies to reverse SepA-mediated resistance in existing infections

By advancing our understanding of SepA function and regulation, researchers can develop targeted approaches to overcome this resistance mechanism, potentially restoring the efficacy of existing antimicrobials and informing the development of new therapeutic agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.