Recombinant Staphylococcus haemolyticus Na (+)/H (+) antiporter subunit B1 (mnhB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will then fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag based on feasibility.
Synonyms
mnhB1; SH2000; Na(+/H(+ antiporter subunit B1; Mnh complex subunit B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhB1
Target Protein Sequence
MNRQNNNLMFQYAAVIIAFLIALFGVTLFFAGHYTPGGGFVGGLLLSCALTIIAIAFDIK TMEKVFPWDFKILIGIGLLFCVATPLASWFYGENFFTHTEFNIPLPLLQPVHMNTPMFFD FGVLCAVVGTIMTIIITIGESE
Uniprot No.

Target Background

Function
Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links

KEGG: sha:SH2000

STRING: 279808.SH2000

Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mnhB1 and how does it function within the multisubunit Na+/H+ antiporter complex?

The mnhB1 subunit is one component of the multisubunit Na+/H+ antiporter (Mnh) in Staphylococcus haemolyticus. Based on homology with similar systems in other staphylococcal species, the Mnh antiporter complex likely consists of multiple subunits that work together to mediate the exchange of Na+ (or Li+) ions for H+ across the bacterial cell membrane . The mnhB1 subunit appears to be critical for proper assembly and function of the antiporter complex, similar to the Na+/H+ antiporter observed in S. aureus where most of a 6kbp DNA insert was necessary for antiporter function .

Functionally, the mnhB1 subunit likely contains transmembrane domains that contribute to the ion translocation pathway. The antiporter system as a whole enables S. haemolyticus to maintain appropriate intracellular pH and Na+ concentrations, particularly under high salinity conditions or alkaline environments, which is critical for bacterial survival under stress conditions .

What expression systems are most effective for producing recombinant mnhB1?

For effective expression of recombinant mnhB1, E. coli-based expression systems have proven particularly suitable. The pET expression system utilizing E. coli BL21(DE3) strains is recommended due to its tight regulation and high expression levels. Alternative approaches include:

Expression SystemAdvantagesChallengesOptimal Conditions
pET/E. coli BL21(DE3)High expression, tight regulationPotential inclusion body formationIPTG induction at 0.1-0.5 mM, 25°C
pBAD/E. coli TOP10Tunable expression levelsLower yieldsL-arabinose induction, 30°C
Cell-free systemsAvoids toxicity issuesHigher cost, lower yieldOptimized reaction buffers with membrane mimetics

When expressing membrane proteins like mnhB1, induction at lower temperatures (16-25°C) can help improve proper folding. Addition of membrane-mimetic environments during purification is essential for maintaining protein stability and function . As demonstrated in studies with other Na+/H+ antiporters, functional expression in E. coli KNabc cells (which lack endogenous Na+/H+ antiporters) can be used to confirm activity through complementation of growth defects in high Na+ or Li+ conditions .

How can researchers accurately assess the ion transport activity of recombinant mnhB1?

Assessment of ion transport activity requires both in vivo and in vitro approaches:

  • In vivo complementation assays: Utilizing antiporter-deficient E. coli strains such as KNabc to evaluate growth restoration under high salt conditions (0.2-0.8 M NaCl or 0.1-0.4 M LiCl) .

  • pH gradient measurements: Using pH-sensitive fluorescent probes (such as BCECF) to monitor intracellular pH changes in response to Na+ addition.

  • Radioisotope flux assays: Measuring the transport of 22Na+ or other isotope-labeled ions in proteoliposomes containing reconstituted mnhB1.

  • Electrophysiological measurements: Recording current changes across membranes containing reconstituted mnhB1 protein using patch-clamp techniques.

The combination of these methods provides comprehensive characterization of transport kinetics, ion selectivity, and regulatory mechanisms. When designing such experiments, it's crucial to establish appropriate controls, including inactive mutants and non-transformed cells, to accurately attribute observed activities to mnhB1 function.

How does the structure of mnhB1 contribute to its ion selectivity and transport mechanism?

The specific structure of mnhB1 remains to be fully elucidated, but comparative analysis with homologous Na+/H+ antiporter subunits suggests several key structural features that contribute to ion selectivity:

The protein likely contains multiple transmembrane helices with conserved charged residues (Asp, Glu) that form the ion translocation pathway. Key structural elements may include:

  • Ion binding sites: Negatively charged residues in transmembrane domains coordinate Na+ or Li+ ions.

  • Conformational switch regions: Residues that facilitate alternating access between cytoplasmic and periplasmic sides.

  • Regulatory domains: Regions that interact with other subunits or respond to environmental signals.

What is the relationship between mnhB1 expression and antimicrobial resistance in S. haemolyticus?

The relationship between Na+/H+ antiporters and antimicrobial resistance is complex and multifaceted. Current research suggests several mechanisms by which mnhB1 may contribute to antimicrobial resistance:

  • Maintenance of ion homeostasis: By regulating intracellular pH and Na+ concentrations, mnhB1 helps maintain optimal conditions for cellular processes even under antimicrobial stress .

  • Biofilm formation: Na+/H+ antiporters have been implicated in biofilm formation, which provides increased resistance to antimicrobials. The mnhB1 subunit may influence biofilm formation through pH regulation or other signaling mechanisms .

  • Stress response regulation: The antiporter system functions as part of the broader stress response network that enables S. haemolyticus to adapt to various environmental challenges, including antibiotic exposure .

Expression of mnhB1 appears to be modulated in response to environmental stressors, suggesting its role in adaptive responses. Studies have shown that S. haemolyticus strains from clinical isolates exhibit high levels of antimicrobial resistance, particularly in hospital environments . The expression of stress response genes, including those involved in ion homeostasis, is often altered in resistant strains.

How do specific inhibitors affect mnhB1 function, and what are their potential therapeutic applications?

Recent studies have identified potential inhibitors of Na+/H+ antiporters in Staphylococcus species:

Inhibitor ClassMechanismIC50 ValuesEffect on Bacterial Viability
Fusaric acid derivatives (e.g., qy17)Disruption of stress response and biofilm formation4-16 μg/mlSignificant growth inhibition
Amiloride analogsDirect binding to ion transport site50-200 μMModerate growth inhibition
Phenolic compoundsMembrane disruption and protein denaturation20-100 μg/mlVariable, depends on compound

The fusaric acid derivative qy17 has shown particular promise by inhibiting S. haemolyticus through multiple mechanisms, including disruption of heat shock (clpB, groES, groL, grpE, dnaK, dnaJ), oxidative stress (aphC), and biotin response (bioB) gene expression . This prevents the bacteria from compensating for various stress conditions, thereby affecting bacterial growth and potentially antiporter function.

The therapeutic potential of mnhB1 inhibitors lies in their ability to disrupt ion homeostasis and stress responses in S. haemolyticus. When developing such inhibitors, researchers should consider:

  • Selectivity for bacterial versus human transporters

  • Ability to penetrate bacterial biofilms

  • Potential for combination therapy with existing antibiotics

  • Resistance development potential

What genomic and transcriptomic approaches can reveal the regulation of mnhB1 expression under various environmental conditions?

Several genomic and transcriptomic approaches can elucidate the regulation of mnhB1:

  • RNA-Seq analysis: Comprehensive transcriptome profiling under various conditions (pH stress, salt stress, antibiotic exposure) can reveal regulatory networks controlling mnhB1 expression. This approach successfully identified altered gene expression patterns in S. haemolyticus in response to inhibitor treatment .

  • ChIP-Seq: Identification of transcription factors that bind to the mnhB1 promoter region.

  • CRISPR interference (CRISPRi): Targeted repression of potential regulators to assess their impact on mnhB1 expression.

  • Promoter reporter assays: Fusion of the mnhB1 promoter with reporter genes (GFP, luciferase) to monitor expression dynamics.

  • Single-cell analysis: Examination of cell-to-cell variation in mnhB1 expression within bacterial populations.

Experimental design should include multiple time points and carefully controlled environmental parameters. Data analysis requires normalization against housekeeping genes and statistical methods to identify significant expression changes.

How does mnhB1 interact with other subunits of the Na+/H+ antiporter complex?

The multisubunit nature of the Na+/H+ antiporter complex necessitates specific interactions between mnhB1 and other subunits for proper assembly and function. Based on studies of similar antiporter systems, these interactions likely involve:

  • Transmembrane helix packing: Specific residues in transmembrane domains mediate helix-helix interactions between subunits.

  • Cytoplasmic domain interactions: Water-soluble domains facilitate assembly and may be involved in regulatory interactions.

  • Lipid-mediated interactions: Specific lipids may stabilize the multisubunit complex in the membrane.

Research approaches to investigate these interactions include:

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify interacting regions

  • FRET analysis: Using fluorescently labeled subunits to detect proximity in live cells

  • Co-immunoprecipitation: Pulling down interacting partners with antibodies against mnhB1

  • Bacterial two-hybrid assays: Detecting protein-protein interactions in vivo

Studies of similar antiporter systems have demonstrated that deletion analysis, where portions of the complex are systematically removed, can reveal essential components. For example, in S. aureus, it was found that most of a 6 kbp DNA insert was necessary for antiporter function, suggesting that multiple subunits work together in a coordinated manner .

What are the optimal purification strategies for obtaining functional recombinant mnhB1?

Purification of membrane proteins like mnhB1 presents significant challenges. The following optimized protocol is recommended:

  • Membrane isolation: Cell disruption followed by differential centrifugation to isolate membrane fractions.

  • Detergent solubilization: Screening of detergents for optimal extraction while maintaining protein stability and function. Common effective detergents include:

DetergentConcentration RangeAdvantagesLimitations
n-Dodecyl-β-D-maltoside (DDM)0.5-2%Mild, maintains functionLarger micelles
n-Decyl-β-D-maltoside (DM)0.5-2%Good extraction efficiencyPotentially destabilizing
Lauryl maltose neopentyl glycol (LMNG)0.01-0.1%Low CMC, stabilizingHigher cost
Digitonin0.5-1%Very mildPoor solubilization
  • Affinity chromatography: Using His-tag, FLAG-tag, or other affinity tags for initial purification.

  • Size exclusion chromatography: For further purification and assessment of protein homogeneity.

  • Reconstitution: Incorporation into proteoliposomes or nanodiscs for functional studies.

Throughout the purification process, it is crucial to maintain appropriate pH (typically 7.0-8.0), salt concentration (100-300 mM NaCl), and include stabilizing agents such as glycerol (10-20%) to preserve protein function. Purification quality should be assessed by SDS-PAGE, Western blotting, and functional assays to ensure the isolated protein retains its native properties.

How can molecular dynamics simulations enhance our understanding of mnhB1 function?

Molecular dynamics simulations provide valuable insights into the dynamics and mechanisms of membrane transporters like mnhB1:

  • Ion pathway identification: Simulations can reveal the pathways and energy barriers for Na+ and H+ transport through the protein.

  • Conformational transitions: Analysis of the conformational changes associated with the transport cycle.

  • Water dynamics: Examination of water molecules in the transport pathway and their role in ion hydration/dehydration.

  • Lipid-protein interactions: Investigation of how specific lipids influence protein structure and function.

Simulation protocols typically include:

  • System preparation with the protein embedded in a lipid bilayer

  • Multiple replicates (3-5) with simulation times of 100-500 ns each

  • Analysis of ion coordination, protein dynamics, and water penetration

Recent advances in computing power allow for longer simulations (microseconds) that can capture rare events in the transport cycle. Enhanced sampling techniques such as umbrella sampling or metadynamics can further elucidate energy landscapes of ion transport.

When developing simulations, researchers should consider:

What are the most effective approaches for studying mnhB1 interactions with potential inhibitors?

Several complementary approaches can effectively characterize mnhB1-inhibitor interactions:

  • Binding assays:

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters

    • Surface plasmon resonance (SPR) for kinetic binding analysis

    • Microscale thermophoresis (MST) for detecting interactions in solution

  • Functional assays:

    • Ion transport assays in proteoliposomes to measure inhibition of activity

    • Growth inhibition assays using complementation systems

    • pH gradient dissipation measurements

  • Structural approaches:

    • Co-crystallization with inhibitors for X-ray crystallography

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding regions

    • NMR spectroscopy for detailed binding site mapping

  • Computational methods:

    • Molecular docking to predict binding modes

    • Free energy calculations to estimate binding affinities

    • Pharmacophore modeling to design improved inhibitors

Studies with fusaric acid derivatives have demonstrated that combining functional genomics approaches (transcriptomics) with growth and biofilm inhibition assays can elucidate both direct effects on the transporter and downstream consequences on cellular physiology .

How might CRISPR-Cas9 gene editing be used to investigate mnhB1 function in S. haemolyticus?

CRISPR-Cas9 technology offers powerful approaches for investigating mnhB1 function:

  • Gene knockout studies: Complete deletion of mnhB1 to assess its essentiality and phenotypic consequences.

  • Point mutations: Introduction of specific mutations to examine the role of conserved residues in transport activity.

  • Domain swapping: Replacement of domains with those from related transporters to investigate functional specificity.

  • Promoter modifications: Alteration of regulatory regions to modulate expression levels.

  • Tagging strategies: Addition of fluorescent or affinity tags for localization and interaction studies.

For S. haemolyticus, which has historically been challenging to genetically manipulate, optimized CRISPR-Cas9 protocols should include:

  • Efficient delivery methods (electroporation or phage-based systems)

  • Appropriate selection markers

  • Careful design of guide RNAs to ensure specificity

  • Comprehensive phenotypic characterization of mutants

Genetic manipulation studies should be combined with physiological assays to link molecular changes to cellular functions. This integrated approach can reveal how mnhB1 contributes to stress tolerance, antimicrobial resistance, and pathogenicity of S. haemolyticus.

What potential roles does mnhB1 play in S. haemolyticus biofilm formation and stress response?

The relationship between Na+/H+ antiporters and biofilm formation represents an exciting frontier in S. haemolyticus research:

  • pH regulation: By maintaining appropriate intracellular pH, mnhB1 may influence the expression of adhesins and extracellular matrix components essential for biofilm formation.

  • Stress response integration: The antiporter system appears to be coordinated with heat shock and oxidative stress responses, as evidenced by studies with inhibitors like qy17 that affect both systems .

  • Signaling functions: Beyond ion transport, mnhB1 may have signaling roles that influence biofilm development.

Research approaches should include:

  • Comparative biofilm assays between wild-type and mnhB1-modified strains

  • Transcriptomic analysis of biofilm versus planktonic cells

  • Visualization of pH gradients within biofilms using fluorescent sensors

  • Testing biofilm formation under various stress conditions

Preliminary evidence suggests connections between Na+/H+ antiporter function and the expression of virulence factors, including PSM-beta toxins (PSMβ1, PSMβ2, PSMβ3) and Clp proteases (clpP, clpX) . The inhibition of these factors by compounds that affect S. haemolyticus growth suggests potential regulatory links between ion homeostasis and virulence mechanisms.

How does mnhB1 from S. haemolyticus compare with homologous proteins in other staphylococcal species?

Comparative analysis of Na+/H+ antiporter subunits across staphylococcal species reveals important evolutionary and functional relationships:

SpeciesAntiporter SystemSequence Homology to S. haemolyticus mnhB1Key Functional Differences
S. aureusMnh/Sha~75-85%Enhanced salt tolerance, potentially different regulation
S. epidermidisMnh~80-90%Similar function, differences in expression patterns
S. saprophyticusMnh~70-80%Adapted to different ecological niches
S. carnosusMnh~65-75%Adaptations for food-associated environments

S. aureus contains a multisubunit Na+/H+ antiporter that requires multiple genes for function, similar to what would be expected for the S. haemolyticus system . This suggests conserved mechanisms across staphylococcal species, though with potential adaptations to specific ecological niches.

Research examining these differences might include:

  • Comparative genomics to identify conserved domains and species-specific variations

  • Heterologous expression studies to test functional interchangeability

  • Analysis of expression patterns in different environments

Understanding these evolutionary relationships can provide insights into the adaptation of staphylococcal species to diverse environmental conditions and help identify conserved features that might serve as targets for broad-spectrum antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.