Recombinant Staphylococcus haemolyticus Na (+)/H (+) antiporter subunit G1 (mnhG1)

Shipped with Ice Packs
In Stock

Description

Function of Na(+)/H(+) Antiporters

Na(+)/H(+) antiporters are membrane-bound proteins that facilitate the exchange of sodium ions (Na+) for hydrogen ions (H+) across cell membranes. This process is essential for maintaining the intracellular pH and osmotic balance, particularly in bacteria facing environmental stressors like high salinity or alkalinity . The antiporter activity consumes a transmembrane electrical potential, which is generated by the proton motive force (PMF) .

Structure and Mechanism

While specific structural details of mnhG1 are not readily available, Na(+)/H(+) antiporters generally consist of multiple subunits that form a complex embedded in the cell membrane. These complexes are hydrophobic and membrane-bound, facilitating the transport of ions across the lipid bilayer . The mechanism involves the exchange of Na+ ions for H+ ions, which helps maintain the cytoplasmic pH and prevents excessive sodium accumulation that could disrupt cellular functions.

Research Findings and Implications

Research on Na(+)/H(+) antiporters in related species like Staphylococcus aureus highlights their critical roles in salt tolerance and pathogenesis . For instance, the Mnh1 and Mnh2 antiporters in S. aureus have distinct pH optima and substrate specificities, contributing to the bacterium's survival under different stress conditions . While similar studies on mnhG1 from Staphylococcus haemolyticus are not detailed in the available literature, it is reasonable to infer that mnhG1 plays a similar role in maintaining cellular homeostasis and potentially influencing the bacterium's virulence and survival capabilities.

Data Tables and Comparative Analysis

Given the lack of specific data on mnhG1, a comparative analysis with related antiporters can provide insights into their functional characteristics. The following table summarizes the properties of Mnh1 and Mnh2 antiporters from Staphylococcus aureus, which might serve as a reference for understanding the potential roles of mnhG1:

AntiporterSubstrateOptimal pHAntiport Activity
Mnh1Na+7.521 ± 1%
Mnh2Na+9.036 ± 1%
Mnh2K+9.039 ± 1%

Table 1: Catalytic Properties of Mnh1 and Mnh2 Antiporters in Staphylococcus aureus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mnhG1; SH2005; Na(+/H(+ antiporter subunit G1; Mnh complex subunit G1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhG1
Target Protein Sequence
MITNIIISLAVIFVILGAIISAVTAIGIIRLKDIYSRGHAAGKSATLGAIFLLFGTFLYF IATDGYINMQLIFGILFILITGPLSSHLIMRAAYNNKTPYTKDTKIDELKNEFKDKMI
Uniprot No.

Target Background

Function
The Mnh complex is a Na+/H+ antiporter involved in Na+ excretion.
Database Links

KEGG: sha:SH2005

STRING: 279808.SH2005

Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.