Recombinant Staphylococcus haemolyticus Probable elastin-binding protein ebpS (ebpS)

Shipped with Ice Packs
In Stock

Description

Introduction

The elastin-binding protein EbpS is a surface protein expressed in Staphylococcus aureus and Staphylococcus haemolyticus that mediates the binding of these bacteria to elastin, a major protein component of the extracellular matrix . This interaction is crucial for the bacteria to attach to host tissues and organs, leading to colonization, invasion, and the formation of metastatic abscesses .

Elastin-Binding Domain

The elastin-binding domain of EbpS is located in the N-terminal region between residues 14-34 . Studies using synthetic peptides and recombinant truncated forms of EbpS have localized the elastin-binding domain to a 21-amino acid region within residues 14-34 . The hexameric sequence Thr18-Asn-Ser-His-Gln-Asp23 is the minimal sequence required for elastin binding .

Functional Significance

EbpS plays a crucial role in the interaction between staphylococci and the extracellular matrix, facilitating bacterial attachment to host tissues . It promotes the binding of soluble elastin peptides and tropoelastin to S. aureus cells . EbpS expression is correlated with the ability of cells to grow to a higher density in liquid culture, suggesting a role in regulating cell growth .

Role in Virulence and Host-Microbe Interactions

EbpS contributes to the virulence of Staphylococcus species by mediating adhesion to host tissues, which is a critical step in colonization and infection . Identifying expressed proteins like EbpS after host-microbe interaction offers a tool for discovering and designing novel targets for antimicrobial treatment .

EbpS Variants

Variants of Staphylococcus aureus EbpS lacking a DNA segment of 180 bp have been identified .

EbpS and CCAAT/Enhancer-Binding Proteins (C/EBPs)

CCAAT/enhancer-binding proteins (C/EBPs) are a family of transcription factors involved in various cellular processes, including cellular proliferation, differentiation, metabolism, and immunity . Although EbpS and C/EBPs share some structural features, such as a leucine zipper domain, they belong to different protein families and have distinct functions . C/EBPs interact with the CCAAT box motif in gene promoters and regulate gene transcription .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
ebpS; SH1431; Probable elastin-binding protein EbpS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
ebpS
Target Protein Sequence
MSKNNFRDDFEKNRQSINSDDQFEDNTNEFDENSNESNDFDNQSDQQFPPRNAQRRQRRR NQATNKNRKFGNQNSDSNANGSLDDRHDEDSFNELQHNQQENHLDNEPIHKDDKLSSEKD FNNDASRRNNRHEASNRKHDKDYDNGSLNDDDRHRRNHEEGIDERQDNRNHKDQQNKKSR HGKDAAIAGGAGVAGAAGAKAAKDKRKKDEHHDSKYNEHKDDRDLNNDNQFDQNRKHDKD LHDDHRDAKDNHSKEEPKKGNKGKKAAVGAGAAGAAGAAGVAAAKHKKDHKNNNHKDNHS HNRDHQDDHRNHKHEDGNDGFQAHNGKKKRGLAGILLPLIALLLILAALAIFIGMYLNND KKDSNQADNKTEQTANKDNNKDSKDKASNDSDKDKASSDKDKDKATNDDDSNDKATTDND SSNNSSDDNSSSSDNSTSSNSSDNSSSSDNNGNNSNSDNNNGNSQATSNNSSQSNSNNNQ SNSSNSGQQTHVVSGNENLYRIAIQYYGEGTVENVNKLKQANGLSSNNISNGQKLIIPQ
Uniprot No.

Target Background

Database Links

KEGG: sha:SH1431

STRING: 279808.SH1431

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the elastin-binding protein EbpS in Staphylococcus haemolyticus?

The elastin-binding protein (EbpS) in Staphylococcus haemolyticus is a surface protein that plays a role in bacterial adhesion mechanisms. Studies have identified EbpS as one of the several surface proteins expressed in S. haemolyticus, including other domain-containing proteins like LPXAG, LPXSG, and LPXTG proteins . Based on comparative analysis with S. aureus EbpS, it likely functions in binding to elastin in host tissues and contributes to bacterial colonization. In S. aureus, EbpS migrates with an apparent molecular mass of approximately 83 kDa and is exclusively located in the cytoplasmic membrane fractions .

What is the clinical significance of S. haemolyticus and its elastin-binding protein?

S. haemolyticus has emerged as an important opportunistic pathogen associated with hospital-acquired infections . It is considered the second most common species of coagulase-negative staphylococci (CoNS) in clinical settings . The bacterium can cause septicemia, peritonitis, otitis, urinary tract infections, and respiratory infections . The elastin-binding protein EbpS is part of the virulence repertoire that may contribute to adhesion and colonization of host tissues. Recent studies have identified emerging multidrug-resistant clones such as ST42 that harbor more virulence genes, including those related to surface proteins . The expression of EbpS may contribute to the pathogen's ability to establish infections, particularly in healthcare environments where it has been increasingly documented in bloodstream infections .

How can researchers effectively express and purify recombinant S. haemolyticus EbpS for experimental studies?

For successful expression and purification of recombinant S. haemolyticus EbpS, researchers should consider the following methodological approach:

  • Gene cloning: Amplify the ebpS gene from S. haemolyticus genomic DNA using PCR with primers designed based on available sequence data. Consider using gateway cloning or restriction enzyme-based approaches to insert the gene into an appropriate expression vector.

  • Expression system selection: Based on data from S. aureus EbpS studies, an E. coli expression system can be effective . Consider using BL21(DE3) or similar strains optimized for membrane protein expression.

  • Domain-based expression: If full-length expression proves challenging, consider expressing separate N-terminal and C-terminal domains, as has been done with S. aureus EbpS (residues 1-267 and 343-486) .

  • Membrane protein extraction: Since EbpS in S. aureus is found exclusively in cytoplasmic membrane fractions , use appropriate detergent-based extraction methods (e.g., n-dodecyl-β-D-maltoside or Triton X-100) to solubilize the protein.

  • Purification strategy: Employ affinity chromatography (His-tag or GST-tag) followed by size exclusion chromatography to achieve high purity.

  • Protein validation: Confirm identity using Western blotting with specific antibodies and mass spectrometry analysis.

What experimental approaches are most suitable for studying the role of EbpS in S. haemolyticus biofilm formation?

To investigate the role of EbpS in S. haemolyticus biofilm formation, researchers should implement these experimental strategies:

  • Gene knockout studies: Generate ebpS deletion mutants using CRISPR-Cas9 or homologous recombination approaches. Compare biofilm formation between wild-type and mutant strains using crystal violet staining assays and confocal laser scanning microscopy.

  • Complementation assays: Reintroduce the ebpS gene in trans to confirm that observed phenotypes are specifically due to the absence of EbpS.

  • Protein localization studies: Use fluorescence microscopy with GFP-tagged EbpS or immunofluorescence with anti-EbpS antibodies to determine protein localization during biofilm formation.

  • Adhesion assays: Quantify adherence to elastin-coated surfaces and human cell lines (e.g., keratinocytes) using wild-type and ebpS mutant strains .

  • Biofilm matrix analysis: Characterize extracellular polymeric substances using techniques such as confocal microscopy with specific stains for polysaccharides, proteins, and extracellular DNA.

  • Gene expression analysis: Monitor ebpS expression under biofilm-inducing conditions using RT-qPCR or RNA-seq to determine regulation patterns.

How does the virulence profile of S. haemolyticus ST42 correlate with EbpS expression and function?

The emerging ST42 clone of S. haemolyticus has been identified as a multidrug-resistant and virulent clone with accumulated antibiotic resistance genes (ARGs) and virulence determinants . To investigate correlations between ST42 virulence and EbpS:

  • Comparative expression analysis: Quantify ebpS expression levels across different S. haemolyticus lineages, particularly comparing ST42 with other sequence types using RT-qPCR and Western blotting.

  • Sequence variation analysis: Compare the ebpS gene sequence among different S. haemolyticus strains to identify potential mutations or polymorphisms specific to ST42 that might enhance protein function.

  • Virulence model assessment: Utilize the Galleria mellonella infection model (as used in previous S. haemolyticus virulence studies ) to compare the virulence of wild-type and ebpS-deficient ST42 strains.

  • Host-pathogen interaction studies: Perform adhesion and invasion assays with human keratinocytes to evaluate whether ST42 strains exhibit enhanced host cell interactions mediated by EbpS .

  • Transcriptomic analysis: Perform RNA-seq to identify genes co-regulated with ebpS in ST42 strains compared to less virulent lineages.

What are the optimal conditions for detecting EbpS expression in clinical S. haemolyticus isolates?

For reliable detection of EbpS expression in clinical S. haemolyticus isolates, researchers should consider the following methodological parameters:

Table 1: Recommended Methods for EbpS Detection in Clinical Isolates

MethodSample PreparationDetection SystemControlsKey Considerations
Western BlottingMembrane fraction extraction using differential centrifugationAnti-EbpS antibodies (consider both N- and C-terminal epitopes)Positive: Recombinant EbpS
Negative: ebpS knockout strain
Expected molecular weight ~83 kDa based on S. aureus data
RT-qPCRRNA extraction during exponential growthebpS-specific primers with appropriate housekeeping gene normalizationPositive: Known ebpS+ strain
Negative: No template control
Growth conditions affect expression
Surface ShavingIntact bacterial cells treated with trypsinLC-MS/MS peptide identificationCytoplasmic protein markers to confirm cell integrityIdentifies surface-exposed domains only
ImmunofluorescenceFixed bacterial cellsFluorescently labeled anti-EbpS antibodiesSecondary antibody only controlDetects spatial distribution

When implementing these methods, it is crucial to grow bacteria under conditions that mimic the host environment, such as in serum-supplemented media or after contact with human keratinocytes, as these conditions have been shown to influence the expression of surface proteins in S. haemolyticus .

How can researchers effectively evaluate the contribution of EbpS to antibiotic resistance mechanisms in S. haemolyticus?

While EbpS itself is not an antibiotic resistance determinant, its role in bacterial adhesion and biofilm formation may indirectly contribute to antimicrobial tolerance. To investigate these relationships:

  • Minimum inhibitory concentration (MIC) determination: Compare antibiotic susceptibilities between wild-type and ebpS-deficient strains using standard broth microdilution methods.

  • Biofilm-associated resistance: Evaluate antibiotic tolerance in biofilm versus planktonic states using the Calgary Biofilm Device or similar systems, comparing wild-type and ebpS mutants.

  • Persister cell formation: Quantify persister cell frequencies in wild-type versus ebpS-deficient strains following antibiotic challenge.

  • Gene expression analysis: Investigate potential regulatory overlap between ebpS and known resistance determinants using transcriptomic approaches under antibiotic stress conditions.

  • Membrane permeability assays: Assess whether EbpS affects membrane structure and thus antibiotic penetration using fluorescent dye uptake assays.

This is particularly relevant given the high rates of methicillin resistance observed in S. haemolyticus isolates, although recent studies in Bangladesh have reported lower rates (9.68%) of methicillin-resistant S. haemolyticus (MRSH) than previous investigations .

What controls should be included when studying recombinant EbpS functionality in adhesion assays?

When investigating recombinant EbpS functionality in adhesion assays, the following controls are essential:

  • Negative controls:

    • Buffer-only control to establish baseline adhesion

    • Irrelevant recombinant protein (similar size/tag) to control for non-specific interactions

    • Heat-denatured EbpS to confirm that native protein conformation is required for function

  • Positive controls:

    • Known adhesion proteins from S. haemolyticus or related species

    • Native (non-recombinant) EbpS extracted from S. haemolyticus membrane fractions

  • Specificity controls:

    • Pre-blocking of substrate (e.g., elastin) with specific antibodies

    • Competitive inhibition using soluble elastin or elastin peptides

    • Dose-response experiments to demonstrate concentration-dependent binding

  • Expression system controls:

    • Empty vector transformants to control for host cell contributions

    • Western blot verification of recombinant protein expression and purification

  • Functional verification:

    • Comparison of adhesion between wild-type S. haemolyticus and ebpS knockout strains

    • Complementation of ebpS knockout with recombinant protein to restore function

How might structural studies of S. haemolyticus EbpS inform the development of anti-adhesion therapeutics?

Structural characterization of S. haemolyticus EbpS could provide valuable insights for therapeutic development:

  • Structure determination approaches:

    • X-ray crystallography of soluble EbpS domains

    • Cryo-electron microscopy for full-length membrane-associated protein

    • NMR spectroscopy for smaller functional domains

    • Molecular dynamics simulations to predict conformational changes during binding

  • Structure-function relationships:

    • Mapping of elastin-binding sites through mutagenesis and binding assays

    • Identification of conserved domains across staphylococcal species

    • Characterization of potential allosteric regulatory sites

  • Anti-adhesion therapeutic strategies:

    • Design of peptide inhibitors targeting the elastin-binding domain

    • Development of antibodies that block functional epitopes

    • Structure-based small molecule screening to identify binding inhibitors

  • Cross-species applications:

    • Comparative analysis with S. aureus EbpS to identify shared binding mechanisms

    • Evaluation of broad-spectrum anti-adhesion approaches effective against multiple staphylococcal species

What genomic approaches could reveal the evolutionary significance of EbpS conservation across S. haemolyticus lineages?

To understand the evolutionary significance of EbpS:

  • Comparative genomics:

    • Whole-genome sequencing of diverse S. haemolyticus isolates, particularly focusing on the ST42 lineage that has shown increased virulence and antibiotic resistance

    • Analysis of ebpS sequence conservation and variation across lineages

    • Identification of potential horizontal gene transfer events involving ebpS

  • Phylogenetic analysis:

    • Construction of ebpS gene trees compared to species trees

    • Evaluation of selection pressures using dN/dS ratios

    • Identification of functionally important residues under purifying selection

  • Population structure analysis:

    • Assessment of ebpS distribution across hospital and community isolates

    • Correlation with other virulence determinants and resistance genes

    • Investigation of potential co-evolution with host factors

  • Pangenome analysis:

    • Determination whether ebpS belongs to the core or accessory genome

    • Identification of genomic islands or mobile genetic elements associated with ebpS

    • Comparison with related staphylococcal species to trace evolutionary history

How can surface shaving proteomics be optimized to study EbpS expression under different host-mimicking conditions?

Surface shaving proteomics has been used successfully to identify S. haemolyticus surface proteins, including EbpS . To optimize this technique for studying EbpS expression:

  • Protocol optimization:

    • Comparison of different proteases (trypsin, proteinase K, chymotrypsin) for surface digestion

    • Optimization of digestion times to minimize cell lysis while maximizing surface protein recovery

    • Evaluation of various buffer compositions to maintain cell integrity during shaving

  • Host-mimicking conditions:

    • Growth in human serum or serum-supplemented media

    • Co-culture with relevant human cell types (e.g., keratinocytes, endothelial cells)

    • Exposure to extracellular matrix components (elastin, collagen, fibronectin)

    • Growth under biofilm-inducing conditions

  • Quantitative approaches:

    • Use of tandem mass tags (TMT) for relative protein quantification across conditions

    • SILAC labeling for direct comparison of protein abundance

    • Label-free quantitation with appropriate normalization strategies

  • Data analysis considerations:

    • Integration of RNA-seq data to correlate transcript and protein levels

    • Network analysis to identify co-regulated surface proteins

    • Temporal profiling to capture dynamic changes in the surface proteome

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.