Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 2 (qoxA)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Staphylococcus haemolyticus Probable Quinol Oxidase Subunit 2 (qoxA) is a bioengineered protein derived from the qoxA gene of S. haemolyticus. This enzyme subunit is part of the bacterial quinol oxidase complex, which facilitates electron transfer during aerobic respiration . The recombinant form is produced in E. coli with an N-terminal His-tag for efficient purification and includes the full-length mature protein spanning residues 20–374 .

PropertyDetail
UniProt IDQ4L565
Gene NameqoxA
SynonymsProbable quinol oxidase subunit 2; Quinol oxidase polypeptide II
Source OrganismStaphylococcus haemolyticus (strain JCSC1435)
Expression HostE. coli
TagN-terminal His-tag

Amino Acid Sequence and Secondary Structure

The recombinant qoxA protein contains 355 amino acids (residues 20–374) with a predicted molecular weight of ~40 kDa. The sequence includes conserved motifs associated with quinol oxidase activity, such as transmembrane helices and catalytic domains . Below is a partial representation of the amino acid sequence:

RegionSequence
N-terminalCSNVEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLTMFAIFIFKYSYNKNSETGKMHHN
MiddleSLIETIWFVVPIIIVIALSIPTVKTLYDYEKPPESKEDPMVVYAVSAGYKWFFAYPEQKVETVNTLTIPKNRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLQADETGTFRGRNSNFNGEGFSRQTFKVHSVDQSEFDSWVKDAKSKKTLSQDEFDKQLLPSTPNKELTFSGTH
C-terminalMAFVDPAADPEYIFYAYKRYNYVQKDPNFVAEKDLYKDVTDKPQKPARKVQITNANYKRHGMKPMILGNNDPYDNEFKKEEDHNSKEMEKISKSAKDENASKFGSKADNDHGGGH

The His-tag enables affinity chromatography purification, achieving >90% purity as confirmed by SDS-PAGE .

Production and Purification

The recombinant qoxA is synthesized in E. coli under optimized conditions to ensure proper folding and solubility. Key steps include:

  1. Expression: Induction of E. coli cultures with IPTG to drive qoxA transcription.

  2. Cell Lysis: Harvesting and lysing bacterial cells to release inclusion bodies.

  3. Purification:

    • His-tag Affinity Chromatography: Binding to Ni-NTA or Ni-IDA columns for selective elution.

    • Gel Filtration: Final polishing to remove contaminants .

ParameterSpecification
Purity>90% (SDS-PAGE)
Reconstitution BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StorageLyophilized powder at -20°C/-80°C; avoid repeated freeze-thaw cycles

Comparative Analysis with Other Staphylococcal Species

qoxA homologs exist in S. aureus (UniProt: Q6GI23) and S. epidermidis (UniProt: Q5HQA9), sharing conserved quinol oxidase subunit domains .

SpeciesUniProt IDProtein Length (aa)Key Differences
S. haemolyticusQ4L565355Unique transmembrane helix configurations
S. aureusQ6GI23347Divergent C-terminal motifs
S. epidermidisQ5HQA9355Distinct N-terminal signal peptides

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
qoxA; SH1901; Probable quinol oxidase subunit 2; Quinol oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-374
Protein Length
Full Length of Mature Protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
qoxA
Target Protein Sequence
CSNVEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLTMFAIFIFKYSYNKNSETGKMHHN SLIETIWFVVPIIIVIALSIPTVKTLYDYEKPPESKEDPMVVYAVSAGYKWFFAYPEQKV ETVNTLTIPKNRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLQADETGTFRGRN SNFNGEGFSRQTFKVHSVDQSEFDSWVKDAKSKKTLSQDEFDKQLLPSTPNKELTFSGTH MAFVDPAADPEYIFYAYKRYNYVQKDPNFVAEKDLYKDVTDKPQKPARKVQITNANYKRH GMKPMILGNNDPYDNEFKKEEDHNSKEMEKISKSAKDENASKFGSKADNDHGGGH
Uniprot No.

Target Background

Function

This protein catalyzes quinol oxidation, concurrently reducing oxygen to water. Subunit II facilitates electron transfer from a quinol to the binuclear center within the catalytic subunit I.

Database Links

KEGG: sha:SH1901

STRING: 279808.SH1901

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus haemolyticus and why is it significant in clinical research?

Staphylococcus haemolyticus is the second most frequently isolated coagulase-negative staphylococci (CoNS) in clinical cases, after Staphylococcus epidermidis. It is a significant nosocomial pathogen associated with a variety of infections including otitis media, skin or soft tissue infections, bacteremia, septicemia, peritonitis, meningitis, and urinary tract infections . The clinical significance of S. haemolyticus has increased substantially due to its ability to acquire antimicrobial resistance genes and serve as a reservoir for these genes, potentially sharing them with other staphylococci, including S. aureus . The emerging pathogenicity and increasing antibiotic resistance make S. haemolyticus an important subject for research in hospital-adapted bacterial evolution.

What is the function of the quinol oxidase subunit 2 (qoxA) in S. haemolyticus?

The qoxA gene encodes a subunit of the quinol oxidase complex, which plays a crucial role in the electron transport chain and cellular respiration of S. haemolyticus. As part of the cytochrome aa3 complex, qoxA contributes to energy production by catalyzing the oxidation of quinol and reduction of oxygen to water. This oxidative phosphorylation process is essential for bacterial metabolism and survival, particularly under aerobic conditions. Understanding qoxA function is important because respiratory chain components can affect bacterial fitness, virulence expression, and potentially influence antibiotic susceptibility patterns.

How do clinical and commensal S. haemolyticus strains differ genetically?

Comparative genomic analysis shows clear segregation between clinical and commensal S. haemolyticus isolates. Clinical isolates typically possess distinct genetic signatures including:

  • Higher prevalence of antibiotic resistance genes, particularly mecA (oxacillin resistance), aacA-aphD (aminoglycoside resistance), and ermC (macrolide resistance)

  • Greater presence of mobile genetic elements, especially IS256 and Tn552/IS481 transposons

  • Predominance of qacA antiseptic resistance genes rather than qacB (which is more common in commensal strains)

  • Distinct versions of folB and folP genes that clearly separate clinical from commensal isolates

  • Presence of specific homologs like serine-rich repeat glycoproteins (sraP) and novel capsular polysaccharide operons potentially related to virulence

Phylogenetic reconstruction typically groups S. haemolyticus isolates into distinct clades with specific distribution patterns of clinical versus commensal isolates, suggesting evolution of specialized hospital-adapted lineages .

What methods are recommended for the genetic characterization of qoxA in S. haemolyticus strains?

For comprehensive genetic characterization of qoxA in S. haemolyticus, a multi-method approach is recommended:

  • Whole Genome Sequencing (WGS): Using next-generation sequencing platforms to obtain complete genomic data. This approach has successfully characterized oxacillin-resistant S. haemolyticus strains and identified their resistance determinants .

  • PCR and Sanger Sequencing: For targeted analysis of the qoxA gene and its flanking regions to identify variations between strains.

  • Comparative Genomic Analysis: Employing bioinformatic tools to compare qoxA sequences across strains, identifying conserved domains and strain-specific variations.

  • Transcriptome Analysis: RNA-Seq to measure qoxA expression levels under different conditions (e.g., antibiotic exposure, oxygen limitation).

  • Phylogenetic Analysis: Constructing phylogenetic trees based on qoxA sequences to understand evolutionary relationships between different S. haemolyticus strains.

When implementing these methods, researchers should ensure proper bacterial identification through 16S rRNA gene sequencing for confirmation, as demonstrated in studies of oxacillin-resistant S. haemolyticus .

How should recombinant qoxA protein be expressed and purified for functional studies?

A methodological approach to expressing and purifying recombinant S. haemolyticus qoxA includes:

  • Vector Selection: Choose an expression vector with appropriate promoter strength and inducibility. For membrane proteins like qoxA, vectors with moderate expression levels are often preferable to avoid toxicity.

  • Expression System: E. coli BL21(DE3) or similar strains are commonly used, but for membrane proteins, specialized strains like C41(DE3) or C43(DE3) may provide better results.

  • Optimization Protocol:

    • Culture temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

    • Induction timing: Induce at mid-log phase (OD600 ≈ 0.6-0.8)

    • Inducer concentration: Titrate IPTG (0.1-1.0 mM) or use auto-induction media

    • Duration: Extended expression times (16-24 hours) at lower temperatures

  • Membrane Protein Extraction:

    • Cell disruption by sonication or high-pressure homogenization

    • Membrane fraction isolation by differential centrifugation

    • Detergent screening (DDM, LDAO, etc.) for optimal solubilization

  • Purification Strategy:

    • Affinity chromatography (His-tag, Strep-tag)

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography if needed

  • Functional Validation:

    • Spectroscopic analysis to confirm heme incorporation

    • Oxygen consumption assays to verify enzymatic activity

    • Reconstitution into proteoliposomes for activity studies

This systematic approach helps ensure proper folding and retention of functional properties essential for downstream structural and functional analyses.

What techniques are most effective for studying qoxA gene expression regulation?

To effectively study qoxA expression regulation in S. haemolyticus, researchers should employ:

  • Reporter Gene Assays: Constructing transcriptional fusions of the qoxA promoter region with reporter genes (e.g., GFP, luciferase) to monitor expression under various conditions.

  • RT-qPCR: Quantitative real-time PCR to precisely measure qoxA transcript levels in response to environmental factors, stress conditions, or antibiotics.

  • RNA-Seq: Transcriptome-wide analysis to understand qoxA expression in the context of global gene expression patterns.

  • ChIP-Seq: To identify transcription factors binding to the qoxA promoter region.

  • EMSA (Electrophoretic Mobility Shift Assay): For in vitro validation of protein-DNA interactions at the qoxA promoter.

  • DNase Footprinting: To precisely map regulatory protein binding sites in the qoxA promoter.

  • CRISPRi: CRISPR interference to selectively repress qoxA expression and evaluate phenotypic effects.

  • Comparative expression analysis: Between clinical and commensal isolates to identify differential regulation patterns, similar to approaches used in examining other S. haemolyticus genes with distinct expression patterns in hospital-adapted strains .

These techniques should be applied in both standard laboratory conditions and under conditions mimicking the clinical environment (antibiotic stress, oxygen limitation, biofilm formation) for comprehensive characterization of regulatory mechanisms.

How does qoxA contribute to antibiotic resistance mechanisms in S. haemolyticus?

The relationship between qoxA and antibiotic resistance in S. haemolyticus involves several potential mechanisms:

  • Respiration and Membrane Potential: As a component of the electron transport chain, qoxA contributes to the establishment of proton motive force across the membrane. Alterations in respiratory activity can affect the uptake of certain antibiotics, particularly aminoglycosides which require membrane potential for cellular entry.

  • Biofilm Formation Connection: Respiratory chain components including quinol oxidases can influence biofilm formation. Since 88% of clinical S. haemolyticus isolates display multi-drug resistance and biofilm formation capacity , investigating qoxA's role in this phenotype is warranted.

  • Metabolic Adaptation: Shifts in respiration efficiency due to qoxA variants may allow adaptation to different oxygen levels in host microenvironments, potentially affecting susceptibility to antibiotics targeting metabolically active cells.

  • Co-regulation with Resistance Genes: Possible co-regulation of qoxA with antibiotic resistance genes in response to environmental stressors. This hypothesis is supported by observations of coordinated gene expression responses in hospital-adapted strains .

  • Oxidative Stress Response: As respiratory chain components generate reactive oxygen species, qoxA function may influence oxidative stress responses, which can modulate antibiotic killing mechanisms.

Research methodologies should include:

  • Comparative gene expression analysis between resistant and susceptible strains

  • Construction of qoxA deletion or overexpression mutants for susceptibility testing

  • Membrane potential measurements using fluorescent probes

  • Correlation studies between qoxA sequence variations and resistance phenotypes

What is the role of qoxA in S. haemolyticus virulence and hospital adaptation?

The role of qoxA in S. haemolyticus virulence and hospital adaptation likely involves:

  • Energy Production for Colonization: Efficient respiratory function through properly functioning qoxA provides energy necessary for colonization and persistence in hospital environments.

  • Adaptation to Microenvironments: Quinol oxidases function across various oxygen concentrations, potentially helping S. haemolyticus adapt to different host niches with varying oxygen availability.

  • Biofilm Formation: Respiratory chain components can influence biofilm development, a key virulence factor. Clinical S. haemolyticus isolates commonly exhibit biofilm-forming capacity alongside oxacillin resistance (mecA) .

  • Co-evolution with Virulence Factors: Genomic analysis shows clinical S. haemolyticus strains possess unique combinations of virulence factors and resistance determinants . The qoxA gene may have co-evolved with these virulence determinants in hospital-adapted lineages.

  • Selection Pressure: Hospital environments with frequent antibiotic and antiseptic use exert selection pressure that may favor specific qoxA variants with optimal function under these conditions.

Research approaches should include:

  • Comparative functional analysis of qoxA between clinical and commensal isolates

  • Animal infection models comparing wild-type and qoxA mutant strains

  • Transcriptomic profiling of qoxA expression during infection or biofilm formation

  • Evolutionary analysis of qoxA sequences across hospital-adapted clades

How do mobile genetic elements influence the evolution of qoxA in clinical S. haemolyticus strains?

Mobile genetic elements (MGEs) could influence qoxA evolution through:

  • Horizontal Gene Transfer: While qoxA itself is typically chromosomally encoded, MGEs can facilitate transfer of regulatory elements or genes that interact with qoxA function.

  • Genomic Rearrangements: MGEs like IS256, which are frequently found in clinical S. haemolyticus isolates , can cause genomic rearrangements that potentially affect qoxA expression or create novel gene fusions.

  • Co-selection Pressure: Antibiotics and antiseptics select for MGEs carrying resistance genes (mecA, ermC, qacA) , potentially creating hitchhiking effects on nearby chromosomal genes like qoxA.

  • Regulatory Interactions: MGE-encoded transcription factors might influence qoxA expression. Clinical isolates contain distinctive MGEs that could alter regulatory networks .

  • Selective Sweeps: The spread of successful hospital-adapted clones carrying specific MGE configurations may have selected for particular qoxA variants that function optimally in these genetic backgrounds.

Methodological approaches to study these effects include:

  • Whole genome sequencing to identify MGEs and their proximity to qoxA

  • Comparative genomics between strains with different MGE profiles

  • Transcriptomic analysis to detect MGE influence on qoxA expression

  • Experimental evolution studies under hospital-relevant selection pressures

What bioinformatic approaches are most effective for analyzing qoxA sequence diversity across S. haemolyticus populations?

For effective analysis of qoxA sequence diversity, researchers should implement:

  • Sequence Alignment and Phylogenetic Analysis:

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Phylogenetic tree construction using Maximum Likelihood or Bayesian approaches

    • Visualization with tools like iTOL or FigTree

  • Population Genetics Metrics:

    • Calculation of nucleotide diversity (π)

    • FST values to quantify population differentiation

    • Tajima's D to detect selection signatures

  • Protein Structure Prediction:

    • Homology modeling based on related quinol oxidases

    • Mapping sequence variations onto predicted structures

    • Analysis of conservation patterns in functional domains

  • Recombination Detection:

    • Methods like GARD or RDP4 to identify recombination events

    • Assessment of horizontal gene transfer using comparative genomics

  • Selection Analysis:

    • dN/dS ratio calculation to detect positive/purifying selection

    • FUBAR or MEME for site-specific selection detection

    • Branch-site models to identify lineage-specific selection

  • Metadata Integration:

    • Correlation of sequence variants with isolation source (clinical vs. commensal)

    • Association with antibiotic resistance profiles

    • Geographic and temporal pattern analysis

  • Network Analysis:

    • Construction of sequence similarity networks

    • Identification of sequence clusters in relation to clinical outcomes

This integrated approach parallels successful methods used in the comparative genomic analysis of clinical and commensal S. haemolyticus isolates, which revealed distinct evolutionary patterns and adaptation signatures .

How can genetic manipulation of qoxA be achieved in S. haemolyticus?

Genetic manipulation of qoxA in S. haemolyticus requires specialized approaches due to challenges with genetic tractability:

Methodological Protocol:

  • Target Selection and Design:

    • Complete sequence analysis of qoxA and flanking regions

    • Design of targeting constructs with 1-2kb homology arms

    • Incorporation of appropriate selection markers

  • Transformation Methods:

    • Electroporation: Optimize parameters specifically for S. haemolyticus

      • Buffer: 0.5M sucrose with 10% glycerol

      • Field strength: 1.8-2.5 kV/cm

      • Capacitance: 25 μF

      • Resistance: 200 Ω

    • Bacteriophage-based transduction if applicable strains are available

    • Protoplast transformation for difficult strains

  • CRISPR-Cas9 Approach:

    • Design sgRNAs specific to qoxA (typically 20 nucleotides)

    • Use temperature-sensitive plasmids like pIMAY for delivery

    • Include repair templates with desired modifications

    • Screen transformants at non-permissive temperatures

  • Allelic Exchange:

    • Two-step selection process using counterselectable markers

    • Initial integration by homologous recombination

    • Resolution step to remove vector backbone

  • Verification Methods:

    • PCR screening of transformants

    • Sanger sequencing to confirm precise modifications

    • RT-qPCR to verify expression changes

    • Phenotypic assays to confirm functional effects

  • Complementation:

    • Reintroduction of wild-type qoxA under native or inducible promoter

    • Use of integration vectors for stable expression

This approach incorporates techniques successfully applied in genomic studies of S. haemolyticus, adapting methods that have revealed the genomic characteristics of oxacillin-resistant strains .

What experimental models are appropriate for studying qoxA function in S. haemolyticus?

Several experimental models can be employed to study qoxA function in S. haemolyticus:

  • In Vitro Cellular Models:

    • Biofilm formation assays: Microtiter plate-based crystal violet staining to quantify biofilm production and assess the impact of qoxA mutations

    • Respiratory activity measurements: Oxygen consumption rates using oxygen electrodes or fluorescent probes

    • Membrane potential assays: Using voltage-sensitive dyes like DiOC2(3)

    • Growth kinetics: Under varying oxygen concentrations and in the presence of respiratory inhibitors

  • Cell Culture Infection Models:

    • Human keratinocytes: To study skin colonization dynamics

    • Endothelial cell lines: For investigating vascular infection mechanisms

    • Macrophage interaction studies: For immune evasion assessment

    • 3D tissue models: Reconstructed human epidermis or ear tissue models for otitis media studies

  • Animal Models:

    • Murine skin infection model: For studying localized infections

    • Catheter-associated infection models: To simulate device-related infections

    • Systemic infection models: For bacteremia studies

    • Otitis media models: Given the isolation of oxacillin-resistant S. haemolyticus from ear swabs

  • Comparative Systems:

    • Co-culture experiments: With other staphylococcal species to study interspecies competition

    • Mixed biofilm models: To investigate community dynamics

    • Clinical vs. commensal strain comparisons: To understand adaptive differences

  • Environmental Simulation Models:

    • Hospital surface persistence assays: To study environmental adaptation

    • Antiseptic challenge models: Using quaternary ammonium compounds to assess qacA/B gene interactions with qoxA

    • Fluctuating oxygen concentration systems: To mimic in vivo conditions

Each model system should incorporate appropriate controls and multiple S. haemolyticus strains from different phylogenetic clades to account for strain-specific differences in qoxA function and regulation.

How can transcriptomic and proteomic analyses be integrated to understand qoxA function in S. haemolyticus?

Integration of transcriptomic and proteomic approaches provides a comprehensive understanding of qoxA function through:

Multi-omics Integration Methodology:

  • Experimental Design Considerations:

    • Paired sampling for transcriptomics and proteomics

    • Multiple timepoints to capture dynamic responses

    • Inclusion of diverse conditions (oxygen levels, antibiotic exposure)

    • Comparison between clinical and commensal isolates

  • Transcriptomic Analysis:

    • RNA-Seq for global gene expression profiling

    • Targeted RT-qPCR for validation of qoxA expression changes

    • sRNA profiling to identify potential post-transcriptional regulators

    • Differential expression analysis between conditions and strains

  • Proteomic Analysis:

    • LC-MS/MS for global protein identification and quantification

    • Targeted analysis of respiratory chain components

    • Membrane proteome enrichment techniques

    • Post-translational modification analysis

  • Data Integration Approaches:

    • Correlation analysis between transcript and protein levels

    • Pathway enrichment analysis incorporating both datasets

    • Regulatory network reconstruction

    • Protein complex identification (quinol oxidase partners)

  • Validation Experiments:

    • Chromatin immunoprecipitation for transcription factor binding

    • Protein-protein interaction studies (co-IP, bacterial two-hybrid)

    • Metabolic flux analysis to connect respiratory function to phenotype

    • Mutant phenotyping guided by multi-omics findings

  • Bioinformatic Analysis Pipeline:

    • Differential expression/abundance testing

    • Co-expression network analysis

    • Enrichment analysis for biological processes

    • Integration with antibiotic resistance and virulence data

This integrated approach helps elucidate:

  • Discrepancies between transcription and translation of qoxA

  • Co-regulated genes and proteins in the respiratory network

  • Strain-specific regulatory mechanisms

  • Connections between qoxA expression and resistance phenotypes

What statistical approaches are recommended for analyzing qoxA expression data across different S. haemolyticus strains?

For robust statistical analysis of qoxA expression data across S. haemolyticus strains, researchers should employ:

  • Experimental Design Considerations:

    • Minimum of 3-5 biological replicates per strain

    • Technical replicates for each biological sample

    • Inclusion of reference genes with stable expression

    • Stratification of strains by clinical/commensal origin

    • Consideration of phylogenetic relationships in sampling strategy

  • Normalization Methods:

    • For RT-qPCR: Multiple reference gene normalization (e.g., using geNorm)

    • For RNA-Seq: RPKM/FPKM or preferably TPM normalization

    • Batch effect correction using ComBat or RUVSeq

    • Consideration of compositional bias in high-throughput data

  • Statistical Testing Framework:

    • Analysis of Variance (ANOVA) with post-hoc tests for multi-strain comparisons

    • Linear mixed-effects models to account for strain relatedness

    • Negative binomial models for RNA-Seq count data

    • Non-parametric alternatives for non-normally distributed data

  • Multiple Testing Correction:

    • Benjamini-Hochberg procedure for controlling false discovery rate

    • Bonferroni correction for stringent family-wise error rate control

    • Q-value calculation for large-scale comparisons

  • Advanced Analytical Approaches:

    • Principal Component Analysis to visualize strain clustering

    • Hierarchical clustering to identify expression patterns

    • Correlation with phenotypic data (antibiotic resistance, biofilm formation)

    • Machine learning classification of clinical vs. commensal strains based on expression profiles

  • Effect Size Estimation:

    • Calculation of fold changes with confidence intervals

    • Cohen's d or other standardized effect size metrics

    • Meta-analysis approaches for combining results across experiments

  • Visualization Strategies:

    • Heat maps for multi-strain comparisons

    • Volcano plots for highlighting significant differences

    • Phylogenetic trees annotated with expression data

    • Network visualizations for co-expression patterns

These approaches should be applied systematically, following strategies similar to those used in comparative genomic analyses that successfully differentiated clinical from commensal S. haemolyticus strains .

How should researchers interpret qoxA sequence variations in the context of S. haemolyticus evolution?

To properly interpret qoxA sequence variations in the evolutionary context of S. haemolyticus:

  • Variation Classification Framework:

    • Synonymous vs. non-synonymous: Classify mutations and calculate dN/dS ratios

    • Conservative vs. non-conservative: Assess amino acid property changes

    • Domain-specific variation: Map mutations to functional domains of the qoxA protein

    • Strain-specific vs. lineage-specific: Differentiate polymorphisms unique to individual strains versus those characterizing clades

  • Evolutionary Context Analysis:

    • Phylogenetic placement: Position variations within the broader S. haemolyticus phylogeny

    • Ancestral state reconstruction: Determine the likely evolutionary history of variants

    • Molecular clock analysis: Estimate when variations emerged

    • Comparison with other staphylococcal species: Identify S. haemolyticus-specific patterns

  • Selection Pressure Interpretation:

    • Evidence of purifying selection suggests functional constraints

    • Positive selection signals may indicate adaptive advantages

    • Relaxed selection could reflect redundant function or changing requirements

    • Diversifying selection might reflect adaptation to different niches

  • Hospital Adaptation Signatures:

    • Correlation with hospital-adapted lineages identified in phylogenetic studies

    • Association with antibiotic resistance phenotypes

    • Co-occurrence with mobile genetic elements prevalent in clinical isolates

    • Temporal patterns in relation to antibiotic use history

  • Functional Implication Assessment:

    • Residues involved in quinol binding

    • Amino acids at subunit interfaces

    • Transmembrane regions affecting membrane insertion

    • Residues potentially involved in proton translocation

This interpretative framework parallels approaches used to understand other genetic signatures distinguishing clinical from commensal S. haemolyticus isolates, helping place qoxA variations within the broader context of hospital adaptation and pathogenicity evolution .

What are the challenges in correlating qoxA variants with antibiotic resistance phenotypes?

Researchers face several methodological challenges when attempting to correlate qoxA variants with antibiotic resistance phenotypes:

  • Confounding Genetic Factors:

    • Co-occurrence of multiple resistance determinants (mecA, ermC, aacA-aphD) in clinical isolates

    • Presence of mobile genetic elements carrying resistance genes

    • Background genetic differences between strains affecting resistance expression

    • Epistatic interactions between qoxA and other genes

  • Phenotypic Testing Limitations:

    • Variability in susceptibility testing methodologies

    • Growth media effects on resistance expression

    • Inoculum effects on MIC determination

    • Heteroresistance phenomena complicating interpretations

  • Causality Determination:

    • Correlation vs. causation distinction

    • Indirect effects of respiratory function on resistance

    • Potential regulatory linkages between qoxA and resistance genes

    • Pleiotropic effects of qoxA mutations

  • Statistical Analysis Challenges:

    • Multiple testing issues when examining numerous antibiotics

    • Small effect sizes requiring large sample numbers

    • Non-linear relationships between qoxA variation and resistance

    • Need for multivariate approaches to control for confounders

  • Experimental Validation Hurdles:

    • Genetic manipulation difficulties in S. haemolyticus backgrounds

    • Maintaining isogenic backgrounds when testing qoxA variants

    • Complementation challenges for membrane proteins

    • Phenotypic stability issues during laboratory passage

Methodological Solutions Table:

ChallengeRecommended ApproachAdvantagesLimitations
Confounding factorsGenome-wide association studies (GWAS)Accounts for genomic backgroundRequires large sample sizes
Directed mutagenesis in isogenic backgroundsDirect causality testingLabor-intensive
Phenotypic variabilityStandardized antimicrobial susceptibility testingComparability across studiesMay not reflect in vivo conditions
Population analysis profilesDetects heteroresistanceTime-consuming
Causality determinationAllelic replacement experimentsEstablishes direct causalityTechnical challenges
Transcriptomic response to antibioticsReveals regulatory networksIndirect evidence
Statistical challengesMachine learning approachesHandles complex interactionsRisk of overfitting
Bayesian network analysisModels conditional dependenciesComputationally intensive

This systematic approach to addressing methodological challenges aligns with strategies used in comparative genomic studies that successfully identified distinctive genetic signatures in clinical S. haemolyticus isolates .

What are the most promising research avenues for understanding qoxA's role in S. haemolyticus pathogenicity?

Several high-priority research directions warrant investigation to elucidate qoxA's role in S. haemolyticus pathogenicity:

  • Structure-Function Studies:

    • Determination of qoxA crystal structure to understand functional domains

    • Site-directed mutagenesis of key residues to map functional regions

    • Comparative structural analysis with qoxA homologs from other staphylococci

  • Respiratory Adaptation in Host Environments:

    • Investigation of qoxA expression under varying oxygen conditions mimicking host niches

    • Analysis of qoxA contribution to survival within phagocytes

    • Evaluation of respiratory chain remodeling during infection

  • Biofilm Dynamics:

    • Assessment of qoxA's role in biofilm formation and maintenance

    • Investigation of respiratory heterogeneity within biofilm structures

    • Examination of qoxA expression in biofilm vs. planktonic states

    • Correlation with clinical biofilm-forming capacity observed in hospital strains

  • Antibiotic Tolerance Mechanisms:

    • Exploration of qoxA-mediated persister cell formation

    • Investigation of respiratory inhibition effects on antibiotic efficacy

    • Analysis of qoxA mutations in strains with reduced susceptibility to last-line antibiotics

  • Host-Pathogen Interaction Studies:

    • Evaluation of qoxA's role in adhesion to host tissues

    • Investigation of respiratory activity during internalization by host cells

    • Analysis of qoxA contribution to immune evasion strategies

  • Evolutionary Dynamics:

    • Tracking qoxA sequence evolution in sequential clinical isolates

    • Experimental evolution studies under antibiotic selection pressure

    • Comparative analysis of qoxA in hospital-adapted versus community strains, building on observed segregation patterns

  • Multi-species Interactions:

    • Investigation of qoxA's role in competition with other microorganisms

    • Analysis of respiratory chain adaptations in polymicrobial infections

    • Examination of interspecies gene transfer affecting qoxA function

These research directions would build upon existing knowledge of S. haemolyticus genomics and hospital adaptation patterns , focusing specifically on respiratory chain components as potential contributors to pathogenicity and multidrug resistance.

How might qoxA research contribute to new therapeutic approaches for multidrug-resistant S. haemolyticus infections?

Research on qoxA could inform several innovative therapeutic strategies for combating multidrug-resistant S. haemolyticus:

  • Respiratory Chain Inhibitors as Adjuvants:

    • Development of qoxA-specific inhibitors to potentiate existing antibiotics

    • Screening of natural product libraries for respiratory chain modulators

    • Repurposing of known respiratory inhibitors for combination therapy

    • Potential to overcome aminoglycoside resistance which is common in clinical isolates (88%)

  • Anti-virulence Strategies:

    • Targeting qoxA-dependent virulence factor expression

    • Disruption of respiratory adaptation during infection process

    • Inhibition of energy-dependent virulence mechanisms

  • Biofilm Disruption Approaches:

    • Exploitation of respiratory heterogeneity in biofilms

    • Development of agents targeting qoxA-dependent biofilm formation

    • Combination therapies coupling respiratory inhibitors with antibiofilm agents

    • Particularly relevant as clinical isolates show both biofilm formation and antibiotic resistance

  • Persister Cell Targeting:

    • Strategies to eliminate respiratory-dormant persisters

    • Metabolic stimulation approaches to sensitize persisters to antibiotics

    • Dual-action therapeutics targeting both active and dormant cells

  • Diagnostic Applications:

    • Development of rapid molecular tests for hospital-adapted qoxA variants

    • Biomarkers for predicting treatment response based on qoxA genotype

    • Point-of-care diagnostics to guide personalized treatment strategies

  • Novel Vaccine Targets:

    • Evaluation of qoxA epitopes as potential vaccine components

    • Investigation of cross-protective immunity against multiple staphylococcal species

    • Development of anti-virulence vaccines targeting respiratory chain components

  • Evolutionary Considerations:

    • Design of treatment strategies with reduced potential for resistance development

    • Exploitation of fitness costs associated with qoxA mutations

    • Multi-target approaches addressing both qoxA and resistance determinants like mecA

This therapeutic research agenda aligns with the observed correlation between antibiotic resistance profiles and genetic signatures in clinical S. haemolyticus strains, suggesting targeted approaches could help address the growing challenge of multidrug-resistant infections .

What collaborations between different scientific disciplines would advance qoxA research in S. haemolyticus?

Advancing qoxA research requires interdisciplinary collaborations integrating:

  • Genomics and Bioinformatics:

    • Large-scale sequencing of S. haemolyticus isolates from diverse sources

    • Advanced phylogenomic analysis of qoxA evolution

    • Machine learning approaches to identify patterns in sequence-phenotype relationships

    • Integration with existing comparative genomic analyses of clinical and commensal strains

  • Structural Biology and Biochemistry:

    • Crystallographic studies of qoxA protein structure

    • Biophysical characterization of quinol oxidase function

    • Enzyme kinetics under varying environmental conditions

    • Structure-based drug design targeting qoxA

  • Microbiology and Molecular Biology:

    • Genetic manipulation of S. haemolyticus for functional studies

    • Transcriptomic and proteomic profiling under infection-relevant conditions

    • Analysis of respiratory chain adaptations during stress responses

    • Investigation of regulatory networks controlling qoxA expression

  • Immunology and Host-Pathogen Interactions:

    • Immune response to S. haemolyticus respiratory components

    • Host cell interactions with bacteria having altered qoxA expression

    • Inflammatory pathway activation by respiratory chain metabolites

    • In vivo infection models assessing qoxA contribution to virulence

  • Clinical Microbiology and Epidemiology:

    • Surveillance of qoxA variants in clinical settings

    • Correlation of qoxA genotypes with treatment outcomes

    • Tracking evolutionary changes in hospital environments

    • Analysis of host factors influencing S. haemolyticus infections

  • Synthetic Biology and Bioengineering:

    • Development of reporter systems for qoxA activity

    • Creation of tunable expression systems for respiratory components

    • Design of S. haemolyticus chassis strains for controlled studies

    • Engineering of respiratory chain variants for comparative analysis

  • Pharmaceutical Sciences and Medicinal Chemistry:

    • High-throughput screening for qoxA inhibitors

    • Medicinal chemistry optimization of lead compounds

    • Formulation strategies for respiratory chain-targeting agents

    • Pharmacokinetic/Pharmacodynamic modeling of combination therapies

Collaboration Framework Table:

Primary DisciplineComplementary FieldCollaborative Research FocusExpected Outcomes
GenomicsClinical MicrobiologyHospital adaptation signatures in qoxAPredictive markers for virulent strains
Structural BiologyMedicinal ChemistryStructure-based inhibitor designNovel therapeutic leads
Molecular MicrobiologyImmunologyqoxA regulation during host interactionInfection intervention points
BioinformaticsEvolutionary BiologySelection pressures on qoxAResistance development models
BiochemistrySynthetic BiologyEngineered respiratory variantsMechanistic understanding

This interdisciplinary approach builds upon the successes of comparative genomic studies that identified distinct signatures in clinical S. haemolyticus isolates through integration of phenotypic, genomic, and evolutionary analyses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.