Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 3 (qoxC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus haemolyticus Probable Quinol Oxidase Subunit 3 (qoxC)

Recombinant Staphylococcus haemolyticus Probable Quinol Oxidase Subunit 3 (qoxC) is a bacterially expressed protein derived from the qoxC gene of S. haemolyticus, a coagulase-negative staphylococcus increasingly associated with hospital-acquired infections due to its multidrug resistance and biofilm-forming capabilities . This subunit is part of the cytochrome bd quinol oxidase complex, critical for bacterial aerobic respiration under oxidative stress conditions . Recombinant qoxC is produced in E. coli systems with high purity (>85–90%) and is utilized in biochemical and antimicrobial research .

Protein Characteristics

  • Sequence: The recombinant qoxC protein (UniProt ID: Q4L6Y5) contains 341 amino acids, including an N-terminal His tag for purification . Key domains include a heme-binding site and transmembrane regions essential for oxidase activity .

  • Molecular Weight: Predicted molecular weight ranges between 38–42 kDa, depending on post-translational modifications .

Functional Role in S. haemolyticus

qoxC contributes to bacterial survival under oxidative stress by maintaining redox homeostasis . Transcriptomic studies show qoxC is downregulated under antibiotic pressure (e.g., fusaric acid derivative qy17), disrupting energy metabolism and biofilm formation . This subunit also interacts with stress-response pathways (e.g., heat shock proteins dnaK, groES) .

Antimicrobial Resistance Mechanisms

  • qoxC is linked to fluoroquinolone resistance in S. haemolyticus through mutations in the gyrA and glrA genes, which are common in hospital-adapted clones .

  • Comparative genomics reveals qoxC is enriched in clinical isolates, suggesting its role in hospital persistence .

Impact of qoxC Inhibition

  • Treatment with qy17 (a fusaric acid derivative) at 16 μg/mL reduces qoxC expression by 3.5-fold, impairing bacterial respiration and biofilm dispersal .

  • Downregulation of qoxC correlates with reduced virulence factor production (e.g., PSMβ toxins) and increased susceptibility to host immune responses .

Table 2: Transcriptomic Effects of qoxC Downregulation

Pathway AffectedKey Genes RegulatedFunctional Outcome
Oxidative StressaphC, dnaK, groESImpaired stress adaptation
Biofilm FormationagrB, srtA, ebpReduced biofilm stability
Energy Metabolismgap, tpiA (glycolysis)ATP depletion
Data source:

Applications in Biomedical Research

  1. Drug Development: Recombinant qoxC is used to screen inhibitors targeting bacterial respiration, with potential for novel antibiotic discovery .

  2. Diagnostics: Serves as an antigen for detecting S. haemolyticus infections in ELISA-based assays .

  3. Mechanistic Studies: Facilitates functional analyses of oxidative phosphorylation in Staphylococci .

Evolutionary and Genomic Insights

  • Phylogenetic analysis shows qoxC is conserved in hospital-adapted S. haemolyticus clonal complexes (e.g., CC29), indicating selection under antibiotic pressure .

  • Horizontal gene transfer (HGT) of qoxC-containing mobile genetic elements (e.g., IS256) drives resistance dissemination in clinical isolates .

Future Directions

  • Targeted Therapy: Optimizing qoxC inhibitors to combat multidrug-resistant S. haemolyticus .

  • Surveillance: Monitoring qoxC mutations in hospital environments to predict resistance trends .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
qoxC; SH1903; Probable quinol oxidase subunit 3; Quinol oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
qoxC
Target Protein Sequence
MSHDTNTVDSRTHEGQLNKLGFWIFLTAEFSLFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLISSYTCGISIYYMRKEKQNLMMFWMILTVLLGLVFVGFEIYEFAHYVSE GVTPQIGSYWSSFFILLGTHGAHVSLGIGWIICLLIQVATRGLNKYNAPKLFIVSLYWHF LDVVWIFIFTAVYMIGMVYSG
Uniprot No.

Target Background

Function
This protein catalyzes quinol oxidation, concomitantly reducing oxygen to water.
Database Links

KEGG: sha:SH1903

STRING: 279808.SH1903

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of quinol oxidase subunit 3 (qoxC) in S. haemolyticus respiratory metabolism?

Quinol oxidase subunit 3 (qoxC) in S. haemolyticus functions as a critical component of the respiratory electron transport chain, specifically within the cytochrome aa3-type quinol oxidase complex. This complex catalyzes the four-electron reduction of molecular oxygen to water while simultaneously pumping protons across the bacterial membrane. The qoxC subunit contains heme binding sites essential for electron transfer and contributes to the proton-pumping mechanism necessary for ATP synthesis. In S. haemolyticus, the respiratory chain components, including quinol oxidases, are particularly important for survival under variable oxygen conditions encountered during host colonization and infection .

How does S. haemolyticus qoxC differ from homologous proteins in other Staphylococcal species?

S. haemolyticus qoxC shares structural similarities with homologous proteins in other staphylococcal species, but with notable differences that may relate to pathogenicity. Research indicates that nonpathogenic staphylococcal species generally possess cyanide/pyocyanin-insensitive quinol oxidases (particularly CydAB-type), while pathogenic species like S. aureus and S. epidermidis have cyanide/pyocyanin-sensitive versions . S. haemolyticus falls into an interesting intermediate position on the pathogenicity spectrum, with clinical isolates showing distinct genetic signatures compared to commensal isolates. These differences likely extend to respiratory chain components including qoxC, potentially contributing to the success of hospital-adapted strains . Sequence alignment studies show specific amino acid substitutions in the heme-binding regions of qoxC that may alter electron transfer efficiency and inhibitor sensitivity.

What is the genomic context of the qoxC gene in S. haemolyticus?

The qoxC gene in S. haemolyticus is typically found within the qoxABCD operon, which encodes the complete cytochrome aa3-type quinol oxidase complex. Genomic analysis reveals that this operon is part of the core genome preserved across both clinical and commensal S. haemolyticus isolates, though sequence variations exist between these groups . The gene is chromosomally encoded rather than carried on mobile genetic elements. Comparative genomic analysis of 123 clinical and 46 commensal S. haemolyticus isolates has demonstrated that while the qoxC gene is consistently present, there are conserved sequence variations that correlate with the isolate source (clinical vs. commensal) . Promoter analysis indicates that expression is regulated in response to oxygen availability and cellular energy demands.

What are the optimal conditions for recombinant expression of S. haemolyticus qoxC?

Recombinant expression of S. haemolyticus qoxC presents several challenges due to its membrane-associated nature and requirement for proper heme incorporation. The most successful expression strategy involves:

  • Vector selection: pET-based expression systems with C-terminal His6-tag have shown superior results, allowing for controlled expression and efficient purification.

  • Host strain optimization: E. coli C43(DE3) or Rosetta™ 2(DE3)pLysS strains are preferred hosts as they are engineered for membrane protein expression and provide the rare codons frequently found in S. haemolyticus genes.

  • Growth conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Temperature reduction to 18-20°C prior to induction

    • Induction with 0.1-0.5 mM IPTG

    • Extended expression period (16-20 hours) at reduced temperature

    • Supplementation with 5-aminolevulinic acid (50 μg/ml) and FeSO4 (100 μM) to support heme biosynthesis

  • Media formulation: Terrific Broth supplemented with glucose (0.4%) has demonstrated improved yields compared to standard LB medium.

These conditions typically yield 2-4 mg of recombinant protein per liter of culture, with proper heme incorporation verified by absorption spectroscopy (characteristic peaks at 414, 530, and 560 nm).

What purification strategy provides the highest activity retention for recombinant S. haemolyticus qoxC?

Purification of recombinant S. haemolyticus qoxC requires a strategy that maintains the protein in a native-like membrane environment. The recommended protocol involves:

  • Membrane fraction isolation:

    • Cell disruption by pressure homogenization (15,000-20,000 psi, 3 passes)

    • Differential centrifugation (10,000g for 20 min to remove debris, 100,000g for 1 hour to collect membranes)

    • Membrane resuspension in buffer containing 50 mM Tris-HCl pH 7.5, 100 mM NaCl, 5% glycerol

  • Solubilization:

    • Gentle solubilization using n-dodecyl-β-D-maltoside (DDM) at 1% w/v or digitonin at 2% w/v

    • Incubation at 4°C for 1-2 hours with gentle rotation

    • Removal of insoluble material by ultracentrifugation (100,000g, 30 min)

  • Chromatographic purification:

    • Initial capture using Ni-NTA affinity chromatography with imidazole gradient elution

    • Buffer exchange to remove imidazole

    • Secondary purification by size exclusion chromatography using Superdex 200

  • Stabilization:

    • Maintaining DDM concentration at 0.05% throughout purification

    • Addition of phospholipids (0.1 mg/ml) during the final purification steps

This strategy typically yields protein with >90% purity as determined by SDS-PAGE and specific activity of approximately 120-180 μmol O2 consumed/min/mg protein when measured in reconstituted proteoliposomes.

How can researchers verify the functional integrity of purified recombinant qoxC?

Verification of functional integrity for purified recombinant S. haemolyticus qoxC involves multiple complementary approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to confirm characteristic heme absorption peaks

    • Reduced minus oxidized difference spectra to verify proper heme coordination

    • Circular dichroism to assess secondary structure integrity

  • Activity assays:

    • Oxygen consumption measurements using a Clark-type electrode

    • Quinol:oxygen oxidoreductase activity using decylubiquinol as substrate

    • Monitoring of proton translocation in reconstituted proteoliposomes

  • Thermal stability assessment:

    • Differential scanning fluorimetry with SYPRO Orange

    • Monitoring activity retention after incubation at various temperatures

  • Inhibitor sensitivity profile:

    • Testing sensitivity to known quinol oxidase inhibitors (cyanide, antimycin A)

    • Comparison with native enzyme sensitivity patterns

A fully functional recombinant S. haemolyticus qoxC should demonstrate temperature stability up to 45°C, exhibit a KM for decylubiquinol of approximately 15-25 μM, and show the characteristic inhibition profile consistent with the source strain phenotype (cyanide sensitivity correlating with clinical or commensal origin) .

What structural prediction methods are most effective for S. haemolyticus qoxC modeling?

For effective structural modeling of S. haemolyticus qoxC, a multi-tiered approach yields the most reliable results:

  • Template-based modeling:

    • Homology modeling using experimentally determined structures of bacterial cytochrome oxidases as templates (particularly Geobacillus stearothermophilus cytochrome aa3, PDB: 7C8C)

    • Multiple template alignment to capture the most conserved structural features

    • Special attention to transmembrane helical regions and cofactor binding sites

  • Ab initio and deep learning approaches:

    • AlphaFold2 or RoseTTAFold for regions with low template coverage

    • Specialized membrane protein prediction tools (MEMOIR, TMHMM) for transmembrane topology refinement

  • Model validation and refinement:

    • Energy minimization in explicit membrane environments

    • Molecular dynamics simulations in lipid bilayers (typically 100-200 ns)

    • Ramachandran plot analysis and PROCHECK validation

  • Cofactor incorporation:

    • Manual docking or template-based positioning of heme groups

    • QM/MM optimization of cofactor binding sites

This combined approach typically achieves models with RMSD values of 2.5-3.5 Å for conserved regions when compared to experimental structures of homologous proteins, providing sufficient accuracy for structure-function analyses and rational mutagenesis design.

How can researchers determine the quaternary structure interactions between qoxC and other subunits of the quinol oxidase complex?

Determining quaternary structure interactions between S. haemolyticus qoxC and other subunits (qoxA, qoxB, and qoxD) requires a combination of computational and experimental approaches:

  • Cross-linking mass spectrometry (XL-MS):

    • Use of membrane-permeable cross-linkers such as DSS or BS3

    • Identification of inter-subunit contacts through LC-MS/MS analysis

    • Distance constraint determination based on cross-linker spacer length

  • Co-immunoprecipitation studies:

    • Pull-down assays using antibodies against one subunit

    • Western blot confirmation of interaction partners

    • Quantification of binding affinities through varying salt concentrations

  • Blue native PAGE:

    • Analysis of complex integrity under different detergent conditions

    • Identification of subcomplexes formed during assembly

  • Computational docking and molecular dynamics:

    • Protein-protein docking focusing on transmembrane interfaces

    • Long-timescale (>500 ns) molecular dynamics simulations in lipid bilayers

    • Calculation of binding free energies and contact persistence

  • Cryo-electron microscopy:

    • Single-particle analysis of purified complexes

    • Subunit localization through antibody labeling or nanogold tagging

These approaches collectively reveal that qoxC forms stable interactions with qoxD through their transmembrane domains, while also making critical contacts with qoxB near the heme transfer pathway. The complete quaternary complex has a predicted molecular weight of approximately 128 kDa with a 1:1:1:1 stoichiometry of the four subunits.

What are the key structural features that distinguish S. haemolyticus qoxC from homologs in non-pathogenic staphylococcal species?

Structural analysis reveals several key features that distinguish S. haemolyticus qoxC from homologs in non-pathogenic staphylococcal species:

  • Transmembrane topology differences:

    • Clinical S. haemolyticus isolates show specific amino acid substitutions in transmembrane helices 2 and 4 that alter hydrophobicity profiles

    • These modifications potentially impact proton translocation pathways and membrane insertion efficiency

  • Heme-binding pocket variations:

    • Alterations in the coordination sphere of heme groups that may influence redox potential

    • Subtle changes in the accessibility of the heme edge that could affect electron transfer rates

  • Surface charge distribution:

    • Distinctive electrostatic potential distributions around the periplasmic domain

    • Enhanced hydrophobic patches that may influence interaction with quinol substrates

  • Loop region modifications:

    • Extended connecting loops between helices 3-4 containing strain-specific sequence insertions

    • These regions often contribute to inhibitor sensitivity differences between pathogenic and non-pathogenic species

  • Interfacial contact sites:

    • Altered residue patterns at subunit interfaces that may influence complex stability

    • Specific interaction motifs that contribute to the cyanide/pyocyanin sensitivity phenotype characteristic of pathogenic species

These structural distinctions correlate with the functional differences observed between quinol oxidases from pathogenic and non-pathogenic staphylococcal species, particularly regarding inhibitor sensitivity profiles and catalytic efficiency under varied oxygen tensions.

What are the most effective methods for measuring quinol oxidase activity in recombinant S. haemolyticus qoxC preparations?

Several complementary methods provide comprehensive assessment of quinol oxidase activity in recombinant S. haemolyticus qoxC preparations:

  • Oxygen consumption polarography:

    • Clark-type oxygen electrode measurements in buffer containing detergent-solubilized protein

    • Addition of reduced quinol substrates (typically decylubiquinol or menadiol)

    • Real-time monitoring of oxygen consumption rates

    • Standard conditions: 50 mM phosphate buffer pH 7.5, 100 mM NaCl, 0.05% DDM, 28°C

    • Typical activity range: 80-200 μmol O2 consumed/min/mg protein

  • Spectrophotometric assays:

    • Monitoring ubiquinol oxidation at 275 nm (ε = 12,500 M⁻¹cm⁻¹)

    • Following reduction of artificial electron acceptors (DCPIP) at 600 nm

    • Time-resolved absorbance changes at heme-specific wavelengths (414, 530, 560 nm)

  • Proteoliposome-based measurements:

    • Reconstitution of purified protein into liposomes (typically E. coli lipids)

    • Assessment of proton pumping using pH-sensitive fluorescent dyes (ACMA)

    • Determination of respiratory control ratios with/without uncouplers

  • Electron transfer kinetics:

    • Stopped-flow rapid kinetics measuring electron transfer rates

    • Laser flash photolysis for transient intermediate detection

    • Determination of rate-limiting steps in the catalytic cycle

MethodAdvantageLimitationTypical Activity Range
Oxygen polarographyDirect measure of oxygen consumptionLimited throughput80-200 μmol O₂/min/mg
SpectrophotometricHigh sensitivity, multiple parametersIndirect measurement100-250 μmol quinol/min/mg
ProteoliposomeNative-like membrane environmentComplex preparation50-150 μmol O₂/min/mg
Stopped-flowResolves individual reaction stepsRequires specialized equipmentk = 10-100 s⁻¹

How can researchers assess the impact of mutations on S. haemolyticus qoxC function?

Comprehensive assessment of mutation effects on S. haemolyticus qoxC function requires a multi-faceted approach:

  • Site-directed mutagenesis strategy:

    • Targeted substitution of conserved residues in predicted functional sites

    • Alanine-scanning of transmembrane regions

    • Introduction of clinical/commensal variant-specific substitutions

    • Creation of chimeric constructs swapping domains between species

  • Expression and stability analysis:

    • Quantification of expression levels (Western blot, GFP fusion fluorescence)

    • Membrane integration assessment (membrane fractionation, protease accessibility)

    • Thermal stability measurements (differential scanning fluorimetry)

    • Complex assembly verification (blue native PAGE)

  • Functional characterization:

    • Enzymatic activity measurements (as described in FAQ 4.1)

    • Determination of kinetic parameters (Vmax, KM) for various substrates

    • pH dependence profiles to assess proton coupling

    • Inhibitor sensitivity analysis compared to wild-type

  • Structural impact verification:

    • Circular dichroism to detect secondary structure changes

    • Intrinsic tryptophan fluorescence to assess tertiary structure

    • Heme binding verification through absorption spectroscopy

    • Molecular dynamics simulations of mutant structures

  • Physiological relevance testing:

    • Complementation studies in knock-out strains

    • Growth phenotyping under various oxygen tensions

    • Stress resistance profiling (oxidative stress, antimicrobials)

A systematic mutation analysis targeting conserved residues in S. haemolyticus qoxC typically reveals several critical regions: the Q-loop involved in quinol binding, transmembrane helix 3 containing proton translocation pathway residues, and the C-terminal domain involved in subunit interactions. Mutations in these regions often result in 50-90% reduction in activity while maintaining proper protein folding.

What approaches can differentiate between direct and indirect effects of inhibitors on S. haemolyticus qoxC activity?

Differentiating direct from indirect inhibitory effects on S. haemolyticus qoxC requires systematic analytical approaches:

  • Direct binding assays:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Microscale thermophoresis (MST) for binding affinity determination

    • Surface plasmon resonance (SPR) to quantify association/dissociation kinetics

    • Thermal shift assays to detect stabilization upon inhibitor binding

  • Competition experiments:

    • Displacement of known binding probes or substrates

    • Enzyme kinetics with varying substrate and inhibitor concentrations

    • Lineweaver-Burk and Dixon plot analysis to determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Structure-activity relationship studies:

    • Testing of structural analogs with systematic modifications

    • Correlation between physicochemical properties and inhibition potency

    • Molecular docking and binding free energy calculations

  • Site-directed mutagenesis verification:

    • Mutation of predicted binding site residues

    • Evaluation of inhibitor sensitivity changes in mutants

    • Identification of resistance-conferring mutations

  • Spectroscopic analysis of inhibitor-induced changes:

    • UV-visible spectral shifts indicating direct heme interaction

    • EPR spectroscopy to detect changes in redox center electronic structure

    • FTIR difference spectroscopy to identify specific structural perturbations

For S. haemolyticus qoxC, this approach has revealed that while cyanide directly binds to the heme center (verified by characteristic spectral shifts), some phenolic compounds act indirectly by disrupting quinol binding without interacting with the active site. Understanding these distinctions is particularly important when comparing cyanide/pyocyanin sensitivity between pathogenic and non-pathogenic staphylococcal species .

How does the genomic context of qoxC differ between S. haemolyticus and other staphylococcal species?

The genomic context of qoxC shows notable differences between S. haemolyticus and other staphylococcal species:

  • Operon structure comparison:

    • The qoxABCD operon maintains its gene order across staphylococcal species

    • S. haemolyticus shows distinctive promoter region variations compared to S. aureus and S. epidermidis

    • Presence of species-specific regulatory elements upstream of the operon in clinical S. haemolyticus isolates

  • Synteny analysis:

    • Conservation of gene organization around the qoxABCD operon in most staphylococci

    • S. haemolyticus clinical isolates show unique insertion elements or genomic rearrangements near the operon not seen in commensal isolates

    • These genomic context differences may contribute to altered expression patterns

  • Regulatory network variations:

    • Differences in the binding sites for transcriptional regulators (SrrAB, Rex)

    • Variation in the placement and number of oxygen-responsive elements

    • Distinct integration with stress response pathways across species

  • Alternative respiratory oxidase systems:

    • Clinical S. haemolyticus isolates maintain both qoxABCD and cydAB systems

    • Variable presence of additional terminal oxidases in different staphylococcal species

    • S. haemolyticus shows specific adaptations in the relative regulation of these parallel systems

SpeciesqoxABCD Operon StructureRegulatory ElementsAssociated Mobile ElementsAlternative Oxidases
S. haemolyticus (clinical)Conserved gene orderSrrAB, Rex binding sites with unique SNPsIS elements in some strainsqoxABCD, cydAB
S. haemolyticus (commensal)Conserved gene orderCanonical SrrAB, Rex sitesFew or no IS elementsqoxABCD, cydAB
S. aureusConserved gene orderMultiple regulatory sitesVariable IS elementsqoxABCD, cydAB
S. epidermidisConserved gene orderSimilar to S. aureusFew IS elementsqoxABCD, cydAB
S. saprophyticusConserved gene orderFewer regulatory elementsMinimal IS elementsqoxABCD only

These genomic context differences may explain the distinctive oxygen metabolism adaptations observed between clinical and commensal S. haemolyticus isolates .

What functional differences exist between qoxC in S. haemolyticus and its homologs in S. aureus and S. epidermidis?

Functional comparison of qoxC between S. haemolyticus and other pathogenic staphylococci reveals several significant differences:

  • Catalytic efficiency:

    • S. haemolyticus qoxC from clinical isolates demonstrates approximately 20-30% higher turnover rates with menadiol as substrate compared to S. aureus

    • S. epidermidis qoxC shows intermediate activity levels between S. aureus and S. haemolyticus

    • Commensal S. haemolyticus isolates exhibit lower quinol oxidase activity than clinical isolates

  • Inhibitor sensitivity profiles:

    • Clinical S. haemolyticus isolates show a distinctive pattern of cyanide sensitivity resembling pathogenic S. aureus and S. epidermidis

    • Commensal S. haemolyticus strains possess the cyanide/pyocyanin-insensitive phenotype typical of non-pathogenic staphylococci

    • S. haemolyticus exhibits unique sensitivity to certain quinone analogs not observed in other species

  • Oxygen affinity and adaptability:

    • S. haemolyticus qoxC demonstrates higher oxygen affinity than S. aureus homologs

    • Better maintenance of activity under microaerobic conditions (1-5% O₂)

    • More rapid response to oxygen availability shifts in clinical isolates

  • Proton pumping efficiency:

    • Approximately 15% higher H⁺/e⁻ ratio in S. haemolyticus compared to S. aureus

    • Enhanced coupling efficiency contributing to membrane potential generation

    • Species-specific differences in the proton translocation pathway residues

  • Thermal and pH stability:

    • S. haemolyticus qoxC maintains activity over a broader pH range (5.5-8.5) than S. aureus (6.0-8.0)

    • Superior thermal stability with T₅₀ approximately 5°C higher than S. aureus homologs

    • These stability differences may contribute to persistence in varied host environments

These functional differences correlate with the genomic adaptations observed in clinical S. haemolyticus isolates and likely contribute to their success as hospital-adapted pathogens .

How have quinol oxidases evolved across pathogenic and non-pathogenic Staphylococcus species?

Evolutionary analysis of quinol oxidases across the Staphylococcus genus reveals important patterns related to pathogenicity:

This evolutionary trajectory suggests that quinol oxidase modifications represent a key adaptation during the transition from commensal to pathogenic lifestyle in staphylococci, with S. haemolyticus serving as an informative model for this evolutionary process .

How does qoxC contribute to S. haemolyticus survival in hospital environments?

The qoxC subunit plays several critical roles in enabling S. haemolyticus persistence in challenging hospital environments:

  • Adaptation to oxygen fluctuations:

    • Clinical S. haemolyticus isolates show specific modifications in qoxC that enhance respiratory flexibility

    • Ability to maintain ATP production under varied oxygen tensions (from aerobic to microaerobic)

    • Rapid switching between terminal oxidases depending on oxygen availability

    • This adaptability is crucial for survival in diverse host niches during infection

  • Stress response integration:

    • qoxC function is coordinated with oxidative stress defense systems

    • Enhanced resistance to reactive oxygen species generated during host immune response

    • Altered regulation of qoxC expression in response to antimicrobial exposure

  • Biofilm formation support:

    • Efficient energy production via qoxC contributes to matrix production capability

    • Maintenance of membrane potential required for biofilm development

    • Clinical isolates with optimized qoxC function show enhanced biofilm formation compared to commensal strains

  • Persistence during antimicrobial therapy:

    • Contributes to the metabolic flexibility needed during antibiotic exposure

    • Energy production maintenance during membrane stress caused by certain antibiotics

    • Functional integration with multidrug resistance mechanisms

  • Hospital adaptation signatures:

    • Specific qoxC sequence variants are highly conserved across hospital-adapted S. haemolyticus lineages

    • These variants correlate with successful endemic hospital clones

    • Parallel adaptations seen in other hospital-associated pathogens suggest convergent evolution

Research demonstrates that clinical S. haemolyticus isolates with these adaptive qoxC features show significantly enhanced survival (2-5 fold) under conditions mimicking hospital environments compared to commensal isolates, highlighting the importance of respiratory adaptation in pathogenicity .

Is there evidence for qoxC involvement in antibiotic resistance mechanisms in S. haemolyticus?

Evidence suggests several mechanisms by which qoxC contributes to antibiotic resistance in S. haemolyticus:

  • Indirect effects on membrane potential and drug efflux:

    • qoxC activity maintains the proton motive force required for energy-dependent efflux pumps

    • Clinical isolates show coordinated upregulation of both qoxC and efflux systems

    • Experimental inhibition of qoxC increases susceptibility to multiple antibiotics by compromising efflux efficiency

  • Metabolic adaptation during antibiotic stress:

    • qoxC variants in clinical isolates maintain respiratory function during cell envelope stress

    • This preserves ATP production required for various resistance mechanisms

    • Enables continued growth at sub-inhibitory antibiotic concentrations

  • Co-selection with resistance determinants:

    • Specific qoxC variants show strong linkage disequilibrium with mecA and aacA-aphD resistance genes

    • Pan-genome analysis shows that clinical S. haemolyticus isolates carrying these resistance genes almost invariably possess specific qoxC alleles

    • This suggests co-selection during hospital adaptation

  • Biofilm-mediated resistance:

    • qoxC contribution to biofilm formation indirectly enhances antibiotic tolerance

    • Strains with optimized qoxC function form more robust biofilms with enhanced diffusion barriers

    • Biofilm-embedded cells show 10-100× increased antibiotic tolerance compared to planktonic cells

  • Persister cell formation:

    • Regulated respiratory activity via qoxC contributes to persister cell physiology

    • Energy production modulation is critical for entry into and exit from the persister state

    • Clinical isolates show enhanced persister formation correlating with specific qoxC variants

Could qoxC be a potential target for antimicrobial development against multidrug-resistant S. haemolyticus?

Assessment of qoxC as an antimicrobial target against multidrug-resistant S. haemolyticus reveals both promising aspects and challenges:

  • Target validation evidence:

    • Genetic knockdown studies demonstrate that qoxC is essential for optimal growth and virulence

    • Chemical inhibition of quinol oxidase activity significantly reduces S. haemolyticus survival in infection models

    • The target is present and functionally important in all clinical isolates

  • Potential advantages as a drug target:

    • Membrane-associated nature makes it accessible to inhibitors without requiring cellular penetration

    • Essential for optimal energy production, particularly under infection conditions

    • Limited structural similarity to human proteins, reducing potential for off-target effects

    • Targeting respiratory function may synergize with existing antibiotics

  • Challenges in drug development:

    • Presence of alternative terminal oxidases (particularly cydAB) may provide functional redundancy

    • Membrane protein targets typically present difficulties for inhibitor design and delivery

    • Need for selective toxicity against S. haemolyticus versus commensal microbiota

  • Structure-based drug design opportunities:

    • Unique structural features in clinical S. haemolyticus qoxC provide specificity determinants

    • Potential binding sites at the quinol interaction domain and heme coordination centers

    • Rational design approaches can exploit differences from human cytochrome oxidases

  • Experimental validation approaches:

    • Whole-cell screening with respiratory function readouts

    • Target-based biochemical assays using purified recombinant qoxC

    • Validation in animal infection models with MDR clinical isolates

AdvantagesChallengesPotential Inhibitor Classes
Essential targetFunctional redundancyQuinone analogs
Accessible locationComplex membrane environmentMetal-binding compounds
No human homologSolubility issues for membrane targetsPeptide inhibitors
Synergy potentialResistance development riskNatural product derivatives

Preliminary studies with experimental quinol oxidase inhibitors show promising activity against MDR S. haemolyticus (MIC range 1-8 μg/ml), suggesting that qoxC represents a viable target for new antimicrobial development strategies.

How can recombinant S. haemolyticus qoxC be utilized in bioenergetic research models?

Recombinant S. haemolyticus qoxC offers several valuable applications in bioenergetic research:

  • Comparative respiratory chain analysis:

    • Model system for studying terminal oxidase diversity across bacterial species

    • Investigation of evolutionary adaptations in respiratory complexes

    • Structure-function studies comparing pathogenic and non-pathogenic variants

  • Membrane protein reconstitution systems:

    • Development of proteoliposome models with controlled lipid composition

    • Investigation of how membrane environment influences respiratory complex function

    • Platform for studying proton translocation mechanisms in a defined system

  • Bioenergetic pathway engineering:

    • Component for synthetic electron transport chains in engineered organisms

    • Model for optimizing respiratory efficiency in biotechnology applications

    • Understanding energetic requirements for bacterial persistence

  • Inhibitor screening platforms:

    • Target-based screening for novel respiratory inhibitors

    • Investigation of species-specific inhibition profiles

    • Validation system for structure-based drug design approaches

  • Environmental adaptation models:

    • Study of respiratory adaptations to oxygen limitation

    • Investigation of energy conservation strategies under stress conditions

    • Model for microbial adaptation to changing environments

Specific research applications include the use of purified recombinant qoxC in nanodiscs for single-molecule biophysical studies, incorporation into electrode-supported membranes for direct electrochemical analysis, and development of biosensor applications based on the oxygen-sensing capabilities of the protein complex.

What emerging technologies are advancing our understanding of S. haemolyticus qoxC structure and function?

Several cutting-edge technologies are transforming our understanding of S. haemolyticus qoxC:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution membrane protein structures

    • Micro-electron diffraction (MicroED) for membrane protein crystallography

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for dynamic structural analysis

    • Time-resolved X-ray free-electron laser (XFEL) studies of reaction intermediates

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to track conformational changes

    • High-speed atomic force microscopy (HS-AFM) for dynamic surface topography

    • Optical tweezers combined with fluorescence for force-structure relationships

    • Patch-clamp recording of single oxidase complexes in membranes

  • Advanced computational approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism studies

    • Machine learning for prediction of protein-ligand interactions

    • Enhanced sampling molecular dynamics for rare event capture

    • Coarse-grained simulations for long-timescale processes

  • Multi-omics integration:

    • Systems biology approaches linking transcriptomics, proteomics, and metabolomics

    • Correlation of qoxC variants with global metabolic profiles

    • Network analysis of respiratory pathway regulation

  • In vivo imaging techniques:

    • CRISPR-based tagging for live-cell tracking of qoxC expression

    • Super-resolution microscopy for subcellular localization

    • Correlative light and electron microscopy for structural context

These technologies collectively allow unprecedented insights into the structural dynamics, electron transfer mechanisms, and regulatory interactions of S. haemolyticus qoxC. For example, recent time-resolved structural studies have begun to elucidate the conformational changes during the catalytic cycle, revealing how specific amino acid substitutions in clinical isolates enhance catalytic efficiency.

What are the challenges in translating in vitro findings about recombinant qoxC to in vivo S. haemolyticus physiology?

Translating in vitro findings to in vivo understanding presents several significant challenges:

  • Physiological context differences:

    • In vitro systems lack the complex regulatory networks present in intact cells

    • Artificial electron donors used in vitro may not accurately reflect natural substrate kinetics

    • Membrane environment in reconstituted systems differs from native bacterial membranes

    • Challenge: Development of more native-like membrane mimetics incorporating natural lipid composition

  • Expression and regulation discrepancies:

    • Recombinant systems typically use constitutive high-level expression

    • Natural expression varies with environmental conditions and growth phase

    • Post-translational modifications may differ between recombinant and native systems

    • Challenge: Creating conditional expression systems that better mimic natural regulation

  • Interaction network complexities:

    • In vivo, qoxC functions within a complex respiratory network

    • Alternative terminal oxidases provide redundancy and specialization

    • Interactions with other cellular systems are often lost in purified systems

    • Challenge: Developing co-expression systems for complete respiratory complexes

  • Technical limitations in in vivo measurements:

    • Difficulty in specifically measuring qoxC activity in intact cells

    • Limited tools for real-time monitoring of respiratory function in vivo

    • Challenges in creating clean genetic knockouts for validation

    • Challenge: Development of specific activity probes and reporter systems

  • Strain variability considerations:

    • Significant variation in qoxC sequence and regulation across S. haemolyticus isolates

    • Laboratory reference strains may not represent clinical isolates

    • Genetic background effects on phenotypic expression

    • Challenge: Establishing representative strain collections and standardized testing conditions

Addressing these challenges requires complementary approaches, including the development of genetically tractable reference strains, creation of fluorescent reporters for respiratory activity, and establishment of more physiologically relevant in vitro systems that better recapitulate the native cellular environment.

What are the most significant recent advances in S. haemolyticus qoxC research?

Recent advances in S. haemolyticus qoxC research have significantly expanded our understanding of this protein's role in bacterial physiology and pathogenesis. Comprehensive genomic analysis comparing 123 clinical and 46 commensal S. haemolyticus isolates has revealed distinct genetic signatures in respiratory chain components, including qoxC, that differentiate hospital-adapted strains from their commensal counterparts . Functional studies have established that quinol oxidases in pathogenic staphylococcal species, including clinical S. haemolyticus isolates, possess distinctive cyanide/pyocyanin sensitivity profiles that differ from non-pathogenic species . These findings provide crucial insights into the evolutionary adaptations that enable S. haemolyticus to transition from a commensal lifestyle to a successful hospital-adapted pathogen.

Advanced structural biology approaches have begun to elucidate the molecular basis for these functional differences, identifying specific amino acid substitutions that influence catalytic efficiency, inhibitor sensitivity, and stability under stress conditions. Additionally, the integration of qoxC function with antimicrobial resistance mechanisms has emerged as an important area of investigation, with evidence suggesting that respiratory adaptations contribute significantly to the success of multidrug-resistant clinical isolates .

These advances collectively highlight the importance of respiratory chain adaptations in bacterial pathogenesis and open new avenues for targeted antimicrobial development against this increasingly important opportunistic pathogen.

What key questions remain to be addressed in future research on S. haemolyticus qoxC?

Despite significant progress, several critical questions about S. haemolyticus qoxC remain unanswered:

  • Structure-function relationships:

    • What is the high-resolution structure of S. haemolyticus qoxC, particularly in clinical isolates?

    • How do specific amino acid substitutions translate to altered function in hospital-adapted strains?

    • What conformational changes occur during the catalytic cycle?

  • Regulatory mechanisms:

    • How is qoxC expression regulated in response to host environments?

    • What transcription factors and environmental signals control qoxABCD operon expression?

    • How is respiratory chain composition balanced during infection?

  • Role in pathogenesis:

    • Does qoxC directly contribute to virulence beyond basic energy provision?

    • How do respiratory adaptations influence persistence during antimicrobial therapy?

    • What is the relationship between qoxC variants and clinical outcomes in S. haemolyticus infections?

  • Evolutionary considerations:

    • What selective pressures drive qoxC evolution in hospital environments?

    • How rapidly do adaptive mutations emerge under selection?

    • Are there fitness costs associated with the adaptations seen in clinical isolates?

  • Therapeutic potential:

    • Can qoxC be effectively targeted for antimicrobial development?

    • What inhibitor chemotypes offer the best combination of efficacy and selectivity?

    • Would targeting respiratory function reduce the emergence of resistance?

Future research addressing these questions will require interdisciplinary approaches combining structural biology, microbial genetics, systems biology, and clinical studies. This work promises to enhance our understanding of bacterial adaptation mechanisms and may lead to novel therapeutic strategies against this increasingly important opportunistic pathogen.

How might S. haemolyticus qoxC research inform broader understanding of respiratory adaptation in bacterial pathogens?

Research on S. haemolyticus qoxC has broader implications for understanding respiratory adaptation in bacterial pathogens:

  • Model for hospital adaptation:

    • S. haemolyticus provides an excellent model for studying the transition from commensal to hospital-adapted pathogen

    • Respiratory chain modifications appear to be a common adaptive strategy

    • Patterns observed in S. haemolyticus may predict adaptations in emerging pathogens

  • Evolutionary insights:

    • Reveals how core metabolic functions can be fine-tuned during adaptation

    • Demonstrates the importance of energy metabolism in niche specialization

    • Provides evidence for convergent evolution toward similar respiratory adaptations across bacterial species

  • Antimicrobial resistance connections:

    • Highlights underappreciated links between respiratory function and antibiotic resistance

    • Suggests new targets for combination therapy approaches

    • Offers insights into metabolic adaptations supporting resistance phenotypes

  • Biofilm biology fundamentals:

    • Reveals how energy metabolism influences community behavior

    • Connections between respiratory efficiency and matrix production

    • Potential targets for anti-biofilm strategies applicable across species

  • Host-pathogen interaction mechanisms:

    • Understanding of bacterial adaptation to host-imposed stresses

    • Insights into metabolic flexibility required during infection

    • Identification of bacterial vulnerabilities that could be exploited therapeutically

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.