Recombinant Staphylococcus haemolyticus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role and Biochemical Function

Lgt initiates lipoprotein maturation by modifying the cysteine residue at position +1 of prolipoproteins. This step is critical for anchoring lipoproteins to bacterial membranes, a process conserved across Gram-negative and Gram-positive bacteria. In S. haemolyticus, Lgt likely follows a similar mechanism:

  • Substrate: Phosphatidylglycerol (donor) and prolipoproteins (acceptor).

  • Product: Diacylglyceryl-modified prolipoprotein and glycerolphosphate.

  • Downstream Steps: Signal peptidase II (Lsp) cleaves the modified prolipoprotein, and N-acyltransferase (Lnt) adds a third acyl group in some species .

StepEnzymeFunction
Diacylglyceryl transferLgtTransfers diacylglyceryl group to cysteine +1 of prolipoprotein .
Signal peptide cleavageLspCleaves diacylated prolipoprotein to release mature lipoprotein .
N-acylation (in some spp.)LntAdds palmitate to cysteine +1, forming triacylated lipoproteins .

Therapeutic Potential and Antibiotic Resistance

Lgt is a validated target in E. coli, where inhibitors disrupt outer membrane integrity, increasing antibiotic susceptibility . In S. haemolyticus, Lgt’s role in membrane stability may similarly render it a target for combating antibiotic-resistant strains:

  • Mechanism: Inhibition of Lgt could impair lipoprotein maturation, compromising membrane structure.

  • Resistance Context: S. haemolyticus is notorious for multidrug resistance (e.g., methicillin, vancomycin) .

Antibiotic ClassResistance MechanismPotential Lgt-Targeting Synergy
β-lactamsmecA (PBP2a production)Lgt inhibition + β-lactams may enhance efficacy
Glycopeptidesvan genes (cell wall alteration)Disrupted membrane permeability
Oxazolidinonescfr gene (target modification)Lgt inhibitors may bypass resistance mechanisms

Genomic and Proteomic Insights

Whole-genome sequencing (WGS) of S. haemolyticus has identified:

  • Accessory genome diversity: High variability in virulence and resistance genes, including lgt homologs .

  • Horizontal gene transfer (HGT): Plasmids and transposons contribute to antibiotic resistance and genetic adaptation .

SourceKey FindingsReference
Clinical isolateslgt linked to membrane protein anchoring
Pan-genomic analysislgt conserved in core genome but variable in accessory genes
MDR clonesST42 lineage associates with high ARG burden and virulence

Research Gaps and Future Directions

Critical areas for investigation include:

  1. Structural studies: Crystallography of S. haemolyticus Lgt to validate conserved residues.

  2. Inhibitor discovery: Development of Lgt-specific inhibitors and in vivo efficacy testing.

  3. Synergistic therapies: Combining Lgt inhibitors with existing antibiotics to counter resistance.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we have in stock, we are happy to accommodate special requests. Please specify your preferred format in your order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. For shipments with dry ice, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
lgt; SH2128; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
lgt
Target Protein Sequence
MLFNLNYIDPTAFSIGPLSIKWYGIIIAVGILIGYFIAQESLKYVGLHKDRLVDVIFYSA IFGFIAARIYFVIFQWPYYAQNPIEIPMIWHGGIAIHGGLLGGFITGIIVCKIKNLNPFQ IGDIVAPSIILAQGIGRWGNFMNHEAHGGPVSRTFLENLHIPEFIIRNMYIEGVYYHPTF LYESIWDILGFIILITIRKHLRVGETFTLYLIWYSIGRFFVEGLRTDSLMLTSHIRVAQL VSVILIIIGLVILIYRRIKYQPSLYKEAGPLTWNSSKAKVKS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: sha:SH2128

STRING: 279808.SH2128

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (lgt) and what is its function in Staphylococcus haemolyticus?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme involved in the first step of bacterial lipoprotein biosynthesis. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins . In S. haemolyticus, as in other bacteria, this post-translational modification is critical for anchoring lipoproteins to the cell membrane, which facilitates various cellular functions including nutrient acquisition, cell wall maintenance, and virulence . The enzyme is particularly important in the context of S. haemolyticus pathogenicity, as this organism has emerged as a significant opportunistic pathogen associated with hospital-acquired infections and carries multiple antibiotic resistance genes .

Why is recombinant S. haemolyticus lgt significant for research purposes?

Recombinant S. haemolyticus lgt holds particular significance for research due to the emerging importance of S. haemolyticus as a multidrug-resistant pathogen. As the second most common species of coagulase-negative staphylococci (CoNS), S. haemolyticus causes severe infections including septicemia, peritonitis, and urinary tract infections . Producing recombinant lgt enables detailed study of this enzyme's structure-function relationship, potentially revealing species-specific characteristics that could be exploited for targeted antimicrobial development. Additionally, recombinant production facilitates investigation of lgt's role in S. haemolyticus pathogenesis, particularly how lipoprotein modifications contribute to immune evasion, adherence to host cells, and virulence expression . Such research is especially relevant given the documented ability of S. haemolyticus to adhere to and invade human cells through mechanisms that may involve surface lipoproteins.

What are the known virulence factors in S. haemolyticus that might interact with lipoproteins modified by lgt?

S. haemolyticus possesses various virulence factors that potentially interact with lipoproteins processed by lgt. Research has shown that many S. haemolyticus clinical isolates, particularly those from the emergent ST42 lineage, carry multiple virulence-related genes . These include capsular biosynthesis genes (capDEFG), which are more prevalent in virulent strains and likely contribute to immune evasion . Studies using primary human skin fibroblast (PHSF) cells have demonstrated that S. haemolyticus can adhere to and invade these cells through a zipper-like mechanism, resulting in decreased cell viability and increased apoptosis . The bacterial surface lipoproteins, which undergo modification by lgt, are likely involved in these adhesion and invasion processes. Additionally, S. haemolyticus induces high levels of pro-inflammatory cytokines when co-cultured with peripheral blood mononuclear cells (PBMCs), suggesting immune modulation capabilities potentially mediated by surface lipoproteins .

What genetic tools are available for studying lgt in S. haemolyticus?

Several genetic tools are available for studying lgt in S. haemolyticus, drawing from approaches used with other Staphylococcal species. Complementation studies, similar to those used for isolating S. aureus lgt by complementing temperature-sensitive E. coli lgt mutants, can be employed . For molecular characterization, researchers can use PCR amplification with species-specific primers designed based on conserved regions of staphylococcal lgt genes. Sequence analysis tools enable comparative genomics approaches to identify conserved functional domains and species-specific variations. Expression systems optimized for Gram-positive bacteria, such as shuttle vectors that replicate in both E. coli and Staphylococcal species, facilitate recombinant production. For functional studies, site-directed mutagenesis can identify critical residues for catalytic activity or substrate binding. Additionally, gene knockout technologies, including CRISPR-Cas9 systems adapted for Staphylococcal species, allow for investigation of lgt's role in bacterial physiology and virulence.

What are the mechanisms of substrate recognition and specificity in S. haemolyticus lgt compared to other bacterial species?

The mechanisms of substrate recognition and specificity in S. haemolyticus lgt likely involve complex interactions with the lipobox motif of prolipoproteins. While specific data for S. haemolyticus lgt is limited, comparative analysis with other bacterial lgt enzymes provides valuable insights. In bacterial species, lgt recognizes the conserved lipobox motif, typically L-[A/S/T]-[G/A]-C, with the cysteine residue being essential for modification . Hydropathic profile analysis suggests that S. aureus lgt, which shares evolutionary lineage with S. haemolyticus lgt, has a similar membrane topology to E. coli lgt despite having only 24% sequence identity . This conservation of structure despite sequence divergence suggests that the catalytic mechanism and substrate binding sites are preserved across species. The specificity likely derives from conserved amino acid residues in the active site that interact with both the phosphatidylglycerol donor and the lipobox motif of the acceptor prolipoprotein. Variations in substrate specificity between species may result from subtle differences in these interaction sites, potentially affecting the efficiency of lipoprotein processing and consequently impacting bacterial membrane integrity and function.

How does lgt expression vary across different growth phases and environmental conditions in S. haemolyticus?

The expression of lgt in S. haemolyticus likely varies across different growth phases and environmental conditions, although specific expression profiles haven't been comprehensively characterized in the literature. Based on studies of bacterial adaptation mechanisms, lgt expression is probably regulated in response to changing environmental conditions that affect membrane composition and integrity. During exponential growth, when rapid cell division necessitates active membrane synthesis, lgt expression is likely upregulated to ensure proper processing of membrane lipoproteins . Under stress conditions such as antibiotic exposure, nutrient limitation, or host immune pressures, S. haemolyticus may modulate lgt expression as part of broader adaptive responses. In hospital environments where S. haemolyticus strains like ST42 have emerged as significant pathogens, selective pressures may have favored regulatory adaptations that optimize lgt expression for survival . The expression patterns may also differ between commensal and pathogenic states, potentially contributing to the transition from skin commensal to opportunistic pathogen that S. haemolyticus undergoes when infecting compromised hosts . Understanding these expression dynamics is crucial for identifying conditions under which targeting lgt might be most effective as an antimicrobial strategy.

What role does lgt play in S. haemolyticus biofilm formation and antibiotic resistance mechanisms?

Lgt likely plays a significant role in S. haemolyticus biofilm formation and antibiotic resistance through its function in lipoprotein processing. Lipoproteins are crucial components of bacterial cell envelopes and can contribute to biofilm formation by mediating adhesion to surfaces and cell-cell interactions . In S. haemolyticus, which forms biofilms that contribute to its persistence in hospital environments, properly processed lipoproteins may facilitate initial attachment and subsequent biofilm maturation. Regarding antibiotic resistance, while lgt itself is not an antibiotic resistance gene, its function in maintaining membrane integrity and composition may indirectly contribute to resistance mechanisms. S. haemolyticus strains, particularly the ST42 lineage, harbor numerous antibiotic resistance genes that confer multidrug resistance . The proper anchoring of lipoproteins involved in cell envelope maintenance, mediated by lgt, could affect membrane permeability and consequently drug uptake. Additionally, some lipoproteins may participate in stress responses that help bacteria survive antibiotic challenge. Research with other bacterial species suggests that mutations affecting lipoprotein processing can alter susceptibility to certain antibiotics, indicating a potential indirect role for lgt in resistance phenotypes.

What are the optimal conditions for cloning and expressing recombinant S. haemolyticus lgt?

The optimal conditions for cloning and expressing recombinant S. haemolyticus lgt involve several critical considerations. Based on successful approaches with related bacterial enzymes, the following methodology is recommended:

ParameterOptimal ConditionRationale
Host systemE. coli BL21(DE3) or C43(DE3)Specialized for membrane protein expression; C43(DE3) better tolerates potentially toxic membrane proteins
Expression vectorpET series with T7 promoterProvides high-level expression with tight regulation
Fusion tagsN-terminal His6 with TEV cleavage siteFacilitates purification while allowing tag removal; N-terminal placement avoids interference with membrane insertion
Growth temperature18-20°C post-inductionReduces inclusion body formation and improves proper folding
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Low IPTG concentration reduces toxicity; induction at mid-log phase optimizes yield
Media supplements1% glucose pre-inductionSuppresses basal expression to prevent toxicity
10 mM phosphatidylglycerolProvides substrate for enzyme activity

For cloning, the lgt gene from S. haemolyticus genomic DNA can be amplified using PCR with primers designed based on conserved regions in staphylococcal lgt genes . For functional validation, complementation assays can be performed using temperature-sensitive E. coli lgt mutants (such as strain SK634) to confirm enzymatic activity, similar to methods used for S. aureus lgt characterization . Due to lgt's membrane protein nature, expression optimization may require screening multiple conditions, with successful expression verified by Western blotting using anti-His antibodies.

What purification strategies are most effective for obtaining active recombinant S. haemolyticus lgt?

Purification of active recombinant S. haemolyticus lgt presents challenges due to its membrane-associated nature, requiring specialized strategies to maintain structural integrity and enzymatic activity:

Purification StepMethodCritical Parameters
Membrane fraction isolationDifferential centrifugation40,000-100,000 × g ultracentrifugation to collect membrane fraction after cell lysis
SolubilizationDetergent extraction1-2% n-dodecyl-β-D-maltopyranoside (DDM) or 1% digitonin; gentler detergents preserve activity
Affinity chromatographyIMAC (Ni-NTA)Buffer containing 0.05-0.1% detergent; pH 8.0; 20-250 mM imidazole gradient elution
Size exclusion chromatographySuperdex 200Removes aggregates and contaminants; buffer with 0.05% detergent
Activity preservationLipid additionSupplementation with E. coli polar lipid extract (0.1-0.5 mg/ml) stabilizes enzyme

Based on studies of membrane-associated enzymes, the purification protocol should be conducted at 4°C throughout to minimize protein degradation . Protein purity can be assessed by SDS-PAGE, with expected molecular weight around 31-32 kDa based on S. aureus lgt (31.6 kDa) . Western blotting with anti-His antibodies confirms identity. Enzyme activity can be verified using an in vitro assay measuring the transfer of radioactively labeled diacylglyceryl from phosphatidylglycerol to a synthetic prolipoprotein substrate. For structural studies, further purification may be necessary, potentially including ion exchange chromatography to remove contaminants with similar molecular weights. Buffer optimization containing glycerol (10-20%) and specific lipids may be required to maintain long-term stability and activity.

How can the enzymatic activity of recombinant S. haemolyticus lgt be accurately measured in vitro?

Accurate measurement of recombinant S. haemolyticus lgt enzymatic activity in vitro requires specialized assays that account for its membrane-associated nature and specific catalytic function:

Assay TypeMethodologyReadout
Radioactive assayTransfer of ³H-labeled phosphatidylglycerol to prolipoprotein substrateScintillation counting of labeled product after TLC separation
Fluorescence-based assayFRET-labeled substrate with quenching released upon modificationFluorescence intensity increase proportional to activity
Mass spectrometryDetection of modified peptide substratesMass shift corresponding to diacylglyceryl addition
Coupled enzymatic assayLinking lgt activity to a secondary reporter reactionColorimetric or fluorometric detection

The most direct and sensitive approach involves using a synthetic peptide substrate containing the lipobox motif (typically 15-20 amino acids) incubated with the purified enzyme and phosphatidylglycerol in detergent micelles . Reaction conditions typically include 50 mM Tris-HCl (pH 7.5-8.0), 150 mM NaCl, 0.1% DDM, and 1-5 mM MgCl₂ at 30-37°C. For kinetic analysis, varying substrate concentrations allows determination of Km and Vmax values. Control reactions should include heat-inactivated enzyme and reactions with known lgt inhibitors. Species-specific variations in activity can be assessed by comparing the efficiency of S. haemolyticus lgt with homologs from other bacterial species under identical conditions. This comparative approach may reveal unique characteristics of S. haemolyticus lgt that could be exploited for selective targeting in antimicrobial development.

What are the most effective approaches for generating site-directed mutants of S. haemolyticus lgt to study structure-function relationships?

Generating site-directed mutants of S. haemolyticus lgt requires strategic approaches to identify and modify key functional residues:

Mutagenesis StrategyMethodologyApplication
Sequence-guided mutagenesisTarget conserved residues identified through multi-species alignmentIdentify catalytic and substrate-binding residues
Alanine scanningSystematic replacement of residues with alanineMap functional domains without introducing steric effects
Cysteine accessibilityIntroduction of cysteine residues with subsequent chemical modificationProbe membrane topology and accessibility
Domain swappingReplace domains with homologous regions from other speciesIdentify species-specific functional elements

Based on structure-function studies of bacterial enzymes like lgt, mutagenesis should prioritize conserved residues identified through alignment of lgt sequences from S. haemolyticus, S. aureus, and other bacterial species . For membrane proteins like lgt, introducing mutations requires careful consideration of membrane topology to avoid disrupting transmembrane domains. The QuikChange site-directed mutagenesis system or Gibson Assembly methods can be used to generate the mutants, with verification by DNA sequencing. Each mutant should be expressed under conditions optimized for the wild-type enzyme and purified using identical protocols to ensure comparable results. Functional characterization should include activity assays, substrate binding analysis, and stability assessments. Circular dichroism spectroscopy can confirm that mutations haven't disrupted secondary structure. For comprehensive analysis, a series of conservative and non-conservative substitutions at each position of interest provides insights into the chemical requirements of functional residues. Complementation assays in lgt-deficient bacterial strains offer validation of in vitro findings in a cellular context.

How can researchers effectively analyze the interaction between recombinant S. haemolyticus lgt and potential inhibitor compounds?

Effective analysis of interactions between recombinant S. haemolyticus lgt and potential inhibitor compounds requires multiple complementary approaches:

Analysis MethodTechniqueInformation Obtained
Enzyme inhibition kineticsIC₅₀ and K<sub>i</sub> determinationPotency and mechanism of inhibition
Thermal shift assayDifferential scanning fluorimetryCompound binding through protein stabilization
Surface plasmon resonanceReal-time binding analysisAssociation/dissociation kinetics
Isothermal titration calorimetryDirect measurement of binding thermodynamicsBinding affinity and thermodynamic parameters
Structural analysisX-ray crystallography or cryo-EM of enzyme-inhibitor complexAtomic details of binding interactions

For initial screening, an in vitro activity assay using purified recombinant S. haemolyticus lgt with its substrate in the presence of varying inhibitor concentrations allows determination of IC₅₀ values . More detailed kinetic analysis with varying substrate and inhibitor concentrations can distinguish between competitive, non-competitive, and uncompetitive inhibition mechanisms. Membrane proteins like lgt present challenges for binding studies due to their hydrophobic nature, necessitating carefully optimized detergent conditions that maintain protein stability without interfering with compound binding. Computational approaches including molecular docking and molecular dynamics simulations can complement experimental data by predicting binding poses and energetics. For cellular validation, inhibitors can be tested against S. haemolyticus cultures with assessment of growth inhibition, changes in membrane integrity, and alterations in lipoprotein processing. Selectivity profiling against human enzymes and other bacterial lgt homologs is essential for evaluating potential as antimicrobial targets. The most promising compounds would show potent inhibition of S. haemolyticus lgt with minimal activity against human enzymes.

How should researchers interpret comparative genomic data when studying S. haemolyticus lgt in the context of multidrug-resistant strains?

When interpreting comparative genomic data for S. haemolyticus lgt in multidrug-resistant strains, researchers should employ a multifaceted analytical approach:

Analysis AspectMethodologyInterpretation Focus
Sequence conservationMultiple sequence alignment across strainsIdentify conserved vs. variable regions with functional implications
Phylogenetic analysisMaximum likelihood or Bayesian tree constructionEvolutionary relationships and selection pressures
Genomic contextAnalysis of genes flanking lgtPotential co-regulation or functional relationships
SNP analysisIdentification of non-synonymous mutationsPotential impact on enzyme function or regulation
Horizontal gene transferDetection of unusual GC content or codon usageEvidence of gene acquisition from other species

Researchers should first establish the degree of conservation of lgt across S. haemolyticus strains, particularly comparing ST42 and other multidrug-resistant lineages with commensal isolates . Specific attention should be paid to non-synonymous mutations that might affect enzyme activity or substrate specificity. The genomic context of lgt can provide insights into potential co-regulation with virulence factors or resistance genes. When analyzing across species, researchers should consider that while S. aureus lgt shares only 24% identity with E. coli lgt, it maintains similar functionality, suggesting that even significantly divergent sequences may preserve essential catalytic mechanisms . Integration with transcriptomic and proteomic data can reveal whether sequence variations correlate with expression differences or post-translational modifications. Researchers should be cautious about inferring functional consequences solely from sequence data, as structural constraints may limit the functional impact of seemingly significant sequence variations. Where possible, computational structure prediction and molecular modeling can help translate sequence differences into structural and functional hypotheses for experimental validation.

What statistical approaches are most appropriate for analyzing differences in lgt activity between clinical and laboratory S. haemolyticus strains?

When analyzing differences in lgt activity between clinical and laboratory S. haemolyticus strains, researchers should employ robust statistical approaches that account for biological variation and experimental design:

Statistical ApproachApplicationConsiderations
Two-way ANOVACompare activity across multiple strains and conditionsAccounts for strain differences and experimental variables
Mixed-effects modelsHandle repeated measurements and nested dataAppropriate for time-course experiments
Non-parametric methodsAnalyze non-normally distributed dataMann-Whitney U or Kruskal-Wallis tests when normality cannot be assumed
Multiple comparison correctionControl for false discovery when comparing many strainsBonferroni, Tukey HSD, or false discovery rate methods
Power analysisDetermine appropriate sample sizeEnsures sufficient statistical power to detect biologically relevant differences

For rigorous analysis, researchers should include multiple clinical isolates (preferably representing different sequence types, including ST42) and laboratory strains . Each experiment should include at least 3-5 biological replicates with 2-3 technical replicates per biological sample. When comparing enzymatic parameters like Km and Vmax, confidence intervals should be calculated alongside point estimates. For kinetic parameters, non-linear regression analysis with appropriate enzyme kinetics models should be employed rather than linearization methods like Lineweaver-Burk plots, which can distort error distribution. Correlation analyses can identify relationships between lgt activity and phenotypic characteristics like antibiotic resistance profiles or virulence in cellular models . When integrating with genomic data, multivariate approaches such as principal component analysis or partial least squares regression can identify patterns linking sequence variations to functional differences. Clear reporting of statistical methods, including assumptions testing and justification for tests chosen, is essential for reproducibility and proper interpretation of results.

How can researchers effectively correlate S. haemolyticus lgt function with virulence phenotypes in infection models?

Effectively correlating S. haemolyticus lgt function with virulence phenotypes in infection models requires integrated experimental approaches and careful analysis:

Experimental SystemMeasurementsAnalysis Approach
Primary human skin fibroblast (PHSF) modelAdhesion, invasion, cytotoxicityQuantitative correlation between lgt expression/activity and cell damage
Isogenic mutant comparisonWild-type vs. lgt-modified strains in same modelDirect attribution of phenotypic differences to lgt
TranscriptomicsGene expression profiles during infectionPathway analysis to identify lgt-dependent virulence mechanisms
Animal infection modelsBacterial burden, tissue damage, immune responseIn vivo relevance of in vitro findings
Human sample analysisExamination of clinical isolates for lgt variationsTranslational relevance to human disease

Researchers should first establish baseline virulence characteristics of S. haemolyticus strains in appropriate models, such as the PHSF cell model where S. haemolyticus has been shown to adhere, invade, and induce apoptosis . Creating isogenic strains with modified lgt (through controlled overexpression, knockdown, or site-directed mutagenesis) provides the most direct evidence for lgt's role in virulence. Quantitative measurements should include adhesion efficiency, invasion rates, cytokine induction, and host cell viability . Correlation analysis between lgt activity levels and these virulence metrics can reveal whether the relationship is linear or threshold-dependent. Time-course experiments are valuable for determining whether lgt's role is most significant during initial attachment, invasion, or intracellular survival phases. Multi-parameter analysis using machine learning approaches can identify complex patterns in the data that might not be evident with univariate statistics. When analyzing clinical isolates, stratification by sequence type (particularly focusing on ST42 strains) and source of isolation can reveal context-dependent associations between lgt function and virulence . Integration with genomic data on virulence factor carriage helps distinguish direct lgt effects from those mediated by co-occurring virulence genes.

What approaches should be used to address data inconsistencies when characterizing recombinant S. haemolyticus lgt activity across different experimental systems?

Addressing data inconsistencies when characterizing recombinant S. haemolyticus lgt activity across different experimental systems requires systematic troubleshooting and standardization:

Inconsistency SourceDiagnostic ApproachResolution Strategy
Protein preparation variationActivity correlation with purity/oligomeric stateStandardized purification protocol with quality thresholds
Assay condition differencesSystematic variation of buffer, pH, temperatureEstablish robustness profile and optimal conditions
Substrate heterogeneityCharacterization of substrate batchesSynthetic substrate with defined composition
Expression system artifactsComparison across multiple expression hostsIdentify and minimize host-specific modifications
Detergent/lipid environmentDetergent/lipid screening panelDefine minimal system that maintains native-like activity

When inconsistencies arise, researchers should first evaluate protein quality using multiple orthogonal methods (SDS-PAGE, size exclusion chromatography, dynamic light scattering) to ensure consistent preparation quality . A reference standard batch of enzyme should be maintained for internal calibration across experiments. Systematic investigation of reaction parameters (pH, ionic strength, temperature, detergent type/concentration) can identify conditions where activity is most robust against small variations. For membrane enzymes like lgt, the lipid environment significantly affects activity; therefore, standardized lipid compositions should be established and maintained across experiments . When comparing data across laboratories or studies, a detailed methods harmonization process should precede data integration. Statistical meta-analysis approaches that account for inter-lab variability can help extract consistent patterns from heterogeneous datasets. For inconsistencies between in vitro and cellular systems, targeted experiments with defined variables can bridge the gap between simplified biochemical assays and complex biological environments. Documentation of all experimental conditions, including seemingly minor details like material suppliers and lot numbers, facilitates troubleshooting of unexpected variations.

How should researchers integrate structural, functional, and clinical data to develop targeted inhibitors of S. haemolyticus lgt?

Integrating structural, functional, and clinical data for developing targeted inhibitors of S. haemolyticus lgt requires a multidisciplinary approach:

Data TypeContribution to Inhibitor DevelopmentIntegration Method
Structural dataBinding site identification and inhibitor designStructure-based virtual screening and pharmacophore modeling
Enzymatic assaysActivity profiling and SAR developmentQuantitative structure-activity relationship (QSAR) analysis
Bacterial susceptibilityTranslation to antimicrobial activityCorrelation analysis between enzyme inhibition and growth inhibition
Clinical isolate testingValidation across diverse strainsStatistical analysis of efficacy across strain collections
Resistance developmentPrediction of resistance mechanismsMolecular dynamics simulations of mutant enzymes with inhibitors

The development process should begin with detailed structural characterization of S. haemolyticus lgt, either through experimental methods (X-ray crystallography, cryo-EM) or comparative modeling based on homologous enzymes . Functional studies identifying catalytic residues through site-directed mutagenesis provide validation of potential binding sites. Inhibitor design should prioritize compounds that interact with highly conserved residues to minimize resistance development while exploiting any unique features of S. haemolyticus lgt for selectivity. A comprehensive compound screening cascade should progress from biochemical assays to cellular systems and ultimately to relevant infection models. Testing against clinical isolates, particularly multidrug-resistant ST42 strains, ensures broad-spectrum activity . Pharmacokinetic and safety profiling must be integrated early in the development process to prioritize compounds with favorable drug-like properties. Machine learning approaches can accelerate this process by predicting compound properties and potential off-target effects from limited data. Ultimately, successful translation requires iteration between structural insights, medicinal chemistry optimization, and biological validation, with each cycle informed by integrated analysis of all available data to guide rational compound evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.