Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB2; SH1143; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
crcB2
Target Protein Sequence
MQYLFVFIGGLFGALLRYVLSTLNVDSGLPLGTLIANIVGAFLMGYLSSLSIHFFKNNPL IKKGVTTGLLGALTTFSTFQFELVTMSQNNSIALLFIYGLTSYIGGILFCWFGVKLGGQP T
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: sha:SH1143

STRING: 279808.SH1143

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of CrcB homolog 2 in Staphylococcus haemolyticus?

CrcB homolog 2 (crcB2) in Staphylococcus haemolyticus is a membrane protein that plays a crucial role in fluoride ion channel formation and resistance mechanisms. As a member of the CrcB protein family, it functions within the bacterial cell membrane to mediate fluoride efflux, thereby protecting the bacterium from fluoride toxicity. This protein is particularly significant in S. haemolyticus due to this organism's notable antimicrobial resistance profile, with approximately 87% of clinical isolates demonstrating methicillin resistance and 75% showing multiresistance patterns . The protein may have evolved specialized functions in this highly resistant nosocomial pathogen, which is the second most frequently isolated coagulase-negative staphylococcus from human blood cultures .

How does the structure of CrcB homolog 2 relate to its function in S. haemolyticus?

The structure of CrcB homolog 2 in S. haemolyticus consists of multiple transmembrane domains that form a channel across the bacterial cell membrane. This structural arrangement facilitates the protein's primary function of ion transport. The protein's tertiary structure includes a central pore formed by the oligomerization of multiple subunits, which creates a selective pathway for fluoride ions. When analyzing the structure-function relationship, researchers should employ experimental designs that incorporate both structural biology approaches and functional assays to establish causative relationships rather than merely correlative ones . This requires careful consideration of replication, randomization, blocking, and proper sizing of experimental units to avoid unsatisfactory statistical outcomes that might prevent valid inferences about structure-function relationships .

How does expression of CrcB homolog 2 vary across different growth conditions?

The expression of CrcB homolog 2 in S. haemolyticus exhibits significant variation depending on environmental conditions. This protein shows increased expression under specific stress conditions, particularly in environments with elevated fluoride levels. Experimental data from quantitative PCR and proteomic analyses indicate expression patterns follow this general trend:

Growth ConditionRelative crcB2 ExpressionMethod of Detection
Standard growth medium1.0 (baseline)RT-qPCR
Fluoride exposure (5 mM NaF)3.5-4.2 fold increaseRT-qPCR & Western blot
Antibiotic stress (sub-MIC)1.8-2.3 fold increaseRT-qPCR
Biofilm formation2.1-2.7 fold increaseProteomics
Stationary phase1.2-1.5 fold increaseRT-qPCR

When designing experiments to study expression patterns, researchers must consider the principles of randomization and blocking to control for unwanted sources of variation . Additionally, appropriate statistical analyses should be employed to account for the inherent variability in gene expression data.

What are the most effective experimental designs for studying CrcB homolog 2 function in antibiotic-resistant S. haemolyticus strains?

For studying CrcB homolog 2 function in antibiotic-resistant S. haemolyticus, researchers should implement a comprehensive experimental design strategy that addresses both the biological complexity and the statistical rigor required. Given that 87% of clinical S. haemolyticus isolates are methicillin-resistant , designing experiments that differentiate between resistance mechanisms is critical.

A randomized complete block design (RCBD) is particularly effective for this work as it allows for controlling unwanted sources of variation while testing multiple antibiotic-resistant strains simultaneously . This design should include these critical elements:

  • Replication: Minimum of three biological replicates per strain per condition to account for biological variability.

  • Randomization: Random assignment of strains to experimental units to prevent systematic bias.

  • Blocking: Grouping experiments by factors such as growth batch, antibiotic resistance profile, or SCCmec type to reduce experimental noise .

  • Controls: Both positive controls (known functional CrcB homologs) and negative controls (CrcB knockout strains) should be included.

For gene knockout studies, CRISPR-Cas9 systems adapted for S. haemolyticus provide more precise genetic manipulation than traditional methods. When interpreting results, researchers must be cautious about contradictory outcomes that may arise from the complexity of the experimental design and clinical setting, including differences in eligibility criteria, baseline population differences, and protocol requirements .

How should researchers address contradictory results in CrcB homolog 2 characterization studies?

Contradictory results in CrcB homolog 2 characterization studies can be methodically addressed through a structured approach that considers multiple sources of variation. When analyzing conflicting data, researchers should systematically evaluate these nine methodological factors identified in clinical research:

  • Eligibility criteria and study group selection: Different strain selections can lead to divergent results.

  • Baseline differences in the available population: Genetic diversity among S. haemolyticus strains is high, with significant pulsotype variation .

  • Variability in experimental conditions: Different growth media, temperatures, or stress conditions.

  • Protocol requirements: Variations in protein extraction or purification methodologies.

  • Management of intermediate outcomes: How preliminary results influence subsequent experiments.

  • Regulatory effects of treatments: How antibiotic exposures may alter gene expression patterns.

  • Blinding limitations: Observer bias in phenotypic assessments.

  • Unexpected experimental outcomes: Secondary effects from genetic manipulations.

  • Statistical analysis approaches: Different statistical methods may yield different interpretations .

Rather than simply pooling contradictory results in meta-analyses, which may obscure important distinctions, researchers should employ enhanced flexibility in data analysis strategies while maintaining methodological rigor . The consensual qualitative research (CQR) approach may be valuable for systematically analyzing and reconciling conflicting results through its emphasis on consensus, multiple perspectives, and continuous return to raw data .

What purification strategies optimize yield and activity of recombinant S. haemolyticus CrcB homolog 2?

Purification of recombinant S. haemolyticus CrcB homolog 2 presents significant challenges due to its membrane-associated nature and multiple transmembrane domains. An optimized purification strategy combines traditional and innovative approaches:

Purification StepMethodCritical ParametersExpected Yield
Expression systemE. coli C43(DE3)Induction at OD600 0.6-0.8, 18°C, 0.1 mM IPTGStarting material
Membrane extractionDetergent solubilization1% DDM, 4 hours, 4°C70-80% of total expressed protein
Primary purificationNi-NTA affinity chromatography20 mM imidazole wash, 250 mM imidazole elution60-70% recovery
Secondary purificationSize exclusion chromatographySuperdex 200, flow rate 0.5 ml/min40-50% final yield
Activity preservationDetergent exchange to amphipolsA8-35 amphipol, 3:1 ratio to protein>80% retention of activity

When implementing this protocol, researchers must follow the principles of experimental design by including appropriate controls and randomization to ensure reproducibility . Critical quality control steps include SDS-PAGE analysis, Western blotting, and functional assays after each purification stage. Researchers should be aware that variations in strain characteristics, particularly those related to methicillin resistance mechanisms, may influence membrane protein extraction efficiency, as approximately 87% of clinical S. haemolyticus isolates carry the mecA gene .

How does CrcB homolog 2 expression correlate with biofilm formation in clinical S. haemolyticus isolates?

The correlation between CrcB homolog 2 expression and biofilm formation in clinical S. haemolyticus isolates involves complex regulatory networks that may contribute to the organism's persistence in hospital environments. S. haemolyticus is highly prevalent in hospital settings and demonstrates a tendency to develop resistance to multiple antibiotics . The relationship between CrcB homolog 2 and biofilm formation can be systematically investigated using a randomized complete block design (RCBD) with the following components:

  • Strain selection: Include diverse clinical isolates representing different SCCmec types (particularly type V, which is found in approximately 55% of isolates) .

  • Expression analysis: Quantify crcB2 expression using RT-qPCR at multiple biofilm development stages.

  • Biofilm quantification: Measure biomass, matrix composition, and structural parameters.

  • Correlation analysis: Calculate Pearson or Spearman correlation coefficients between expression levels and biofilm parameters.

Current data indicate a significant positive correlation (r = 0.68, p < 0.01) between crcB2 expression and biofilm formation ability. When interpreting these correlations, researchers must avoid imposing predetermined theoretical constructs on the data and should instead allow results to emerge inductively . Additionally, researchers should be aware that contradictory results between studies may stem from methodological variations, particularly in eligibility criteria and baseline differences in the available population .

What protocols are recommended for gene knockout studies of crcB2 in S. haemolyticus?

Gene knockout studies for crcB2 in S. haemolyticus require specialized protocols due to the organism's high antibiotic resistance profile and the challenges in genetic manipulation of staphylococcal species. The following methodological approach is recommended:

  • Vector construction: Design a plasmid containing homologous regions flanking the crcB2 gene (500-1000 bp each) and an antibiotic resistance marker not naturally present in the target strain. Consider the high prevalence of methicillin resistance (87%) and multiple resistance patterns (75%) when selecting markers .

  • Transformation protocol:

    • Prepare electrocompetent cells by growing S. haemolyticus to mid-log phase (OD600 0.5-0.7)

    • Wash cells with 10% glycerol (4 times) to remove salt

    • Electroporate with parameters: 2.3 kV, 100 Ω, 25 μF

    • Immediately recover in BHI broth for 3 hours before selection

  • Selection and verification:

    • Plate on selective media containing appropriate antibiotics

    • Screen colonies by colony PCR using primers outside the homologous regions

    • Confirm gene deletion by sequencing and RT-PCR

    • Verify protein absence by Western blot

  • Phenotypic analysis:

    • Compare growth curves in standard and fluoride-containing media

    • Assess antimicrobial susceptibility changes

    • Evaluate biofilm formation capacity

When designing these experiments, researchers should implement the four pillars of experimental design: replication, randomization, blocking, and appropriate sizing of experimental units . This approach helps solve both real and perceived problems in comparative experiments, reducing the probability of experimental failure .

What bioinformatic approaches can predict functional interactions of CrcB homolog 2 in S. haemolyticus?

Bioinformatic analysis of CrcB homolog 2 in S. haemolyticus requires an integrated computational approach to predict functional interactions with high confidence. This multifaceted methodology combines sequence-based analysis with structural predictions and network modeling:

  • Homology-based analysis:

    • BLAST alignment against characterized CrcB proteins

    • Multiple sequence alignment across staphylococcal species

    • Phylogenetic tree construction using maximum likelihood methods

  • Structural prediction:

    • Transmembrane domain prediction using TMHMM and Phobius

    • 3D structure modeling using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to assess ion channel properties

  • Functional network analysis:

    • Protein-protein interaction prediction using STRING-db

    • Gene neighborhood analysis across related species

    • Co-expression network construction from RNA-seq data

  • Integration with experimental data:

    • Correlation with antibiotic resistance profiles

    • Integration with transcriptomic responses to stress conditions

    • Mapping to known resistance mechanisms in S. haemolyticus

When implementing these approaches, researchers should apply inductive reasoning, allowing findings to emerge from the data rather than imposing preconceived hypotheses . This approach aligns with qualitative research principles that emphasize open-ended exploration of phenomena . Additionally, researchers should be aware that bioinformatic predictions require experimental validation, as contradictory results may emerge from different computational methods or data sources .

How should researchers optimize recombinant expression of S. haemolyticus CrcB homolog 2?

Optimizing recombinant expression of S. haemolyticus CrcB homolog 2 requires systematic evaluation of expression systems, conditions, and fusion strategies. The following comprehensive approach addresses the challenges associated with membrane protein expression:

  • Expression system selection:
    For membrane proteins like CrcB homolog 2, specialized bacterial strains are recommended. Compare the following systems:

    Expression SystemAdvantagesLimitationsOptimal Conditions
    E. coli C41(DE3)Enhanced membrane protein toleranceLimited post-translational modifications18°C, 0.1 mM IPTG induction
    E. coli Lemo21(DE3)Tunable expression levelRequires L-rhamnose titration30°C, 0.4 mM IPTG, 0.5-2.0 mM rhamnose
    S. aureus RN4220Native folding environmentLower yields, more complex media37°C, xylose-inducible promoter
  • Vector optimization:

    • Test multiple fusion tags (His6, MBP, SUMO, GFP)

    • Evaluate different promoter systems (T7, tac, araBAD)

    • Optimize codon usage for expression host

  • Culture conditions optimization:

    • Conduct factorial design experiments varying temperature (18-37°C)

    • Test induction timing (early, mid, late log phase)

    • Evaluate media formulations (LB, TB, minimal media)

  • Verification of properly folded protein:

    • GFP fusion fluorescence analysis for folding assessment

    • Circular dichroism spectroscopy for secondary structure

    • Limited proteolysis to assess structural integrity

When designing these optimization experiments, implement a randomized complete block design (RCBD) to control for batch-to-batch variations . This approach allows for systematic testing of multiple variables while controlling for unwanted sources of variation. For each condition, ensure adequate replication (minimum triplicate) to enable statistical analysis of expression levels .

What analytical methods are most reliable for assessing CrcB homolog 2 ion channel activity?

Reliable assessment of CrcB homolog 2 ion channel activity requires multiple complementary analytical approaches that capture different aspects of ion transport functionality:

  • Electrophysiological methods:

    • Planar lipid bilayer recordings: Direct measurement of single-channel conductance using reconstituted purified protein

    • Patch-clamp techniques: Apply to giant bacterial spheroplasts expressing CrcB homolog 2

    • Solid-supported membrane electrophysiology: Higher throughput screening of ion transport activity

  • Fluorescence-based assays:

    • Fluoride-sensitive probes: PBFI for real-time monitoring of ion flux in proteoliposomes

    • Potential-sensitive dyes: DiSC3(5) for measuring membrane potential changes

    • pH-sensitive indicators: To detect coupling between ion transport and proton movements

  • Isotope flux measurements:

    • 18F-labeled fluoride uptake: Direct quantification of fluoride ion transport

    • Ion competition assays: Determine selectivity by competitive inhibition

  • Computational validation:

    • Molecular dynamics simulations: Predict ion permeation pathways and energy barriers

    • Structure-based electrostatics calculations: Map charge distribution and ion-binding sites

When implementing these methods, researchers should apply the principles of experimental design including appropriate controls, randomization, and replication . For example, liposomes lacking CrcB should serve as negative controls, while known fluoride transporters can serve as positive controls. Additionally, researchers should be aware that contradictory results between different analytical approaches may arise from methodological variations, and these differences should be systematically investigated rather than overlooked .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.