Recombinant Staphylococcus haemolyticus Putative antiporter subunit mnhB2 (mnhB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhB2; mrpB2; SH2274; Putative antiporter subunit mnhB2; Mrp complex subunit B2; Putative NADH-ubiquinone oxidoreductase subunit mnhB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhB2
Target Protein Sequence
MKENDVVLRTVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVHEV LESLPIDFKKLMIVGAIISALTAIVPVFFGKSFLYQSEAYIHFPLLGELHVTTITLFELG ILLTVVGVIVTIMLALSGGKS
Uniprot No.

Target Background

Database Links

KEGG: sha:SH2274

STRING: 279808.SH2274

Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus haemolyticus and what is its clinical significance?

Staphylococcus haemolyticus is an opportunistic bacterial pathogen commonly found on human skin, particularly in the axillae, perineum, and inguinal areas. It is a member of the coagulase-negative staphylococci group and is the second most frequently isolated staphylococcal species from human blood cultures after S. epidermidis . S. haemolyticus is a significant cause of nosocomial infections, particularly medical device-related infections, and can cause septicemia, peritonitis, otitis, and urinary tract infections .

Clinical significance stems primarily from its remarkable ability to develop resistance to multiple antibiotics, including methicillin and glycopeptides . Additionally, S. haemolyticus can form biofilms on medical devices, further contributing to its pathogenicity in healthcare settings . The bacterium is also capable of acquiring and transferring resistance elements like the SCCmec cassette to other staphylococci, potentially serving as a reservoir for antimicrobial resistance genes .

What is the genomic context of the mnhB2 antiporter subunit in S. haemolyticus?

The mnhB2 antiporter subunit gene in S. haemolyticus exists within a highly dynamic genomic environment. The complete genome sequencing of S. haemolyticus strain JCSC1435 revealed numerous antibiotic resistance genes and an extraordinary number of insertion sequences (ISs) . These genomic features contribute to frequent phenotypic alterations and genomic rearrangements.

While the specific genomic context of mnhB2 isn't detailed in the available data, research on S. haemolyticus has identified a region of the bacterial chromosome just downstream of the origin of replication, designated the "oriC environ," that shows little homology among staphylococcal species but is conserved within species . This region is enriched for species-specific nonessential genes that contribute to the biological features of each staphylococcal species, potentially including membrane proteins like antiporters.

The genomic plasticity of S. haemolyticus, facilitated by as many as 82 insertion sequences identified in the chromosome, likely affects the genetic context and expression of the mnhB2 gene through frequent rearrangements that result in phenotypic diversification .

What is the putative function of the mnhB2 antiporter subunit in S. haemolyticus?

The mnhB2 protein in S. haemolyticus functions as a putative antiporter subunit, which typically means it is involved in membrane transport processes that exchange one substrate for another across the cell membrane. Based on homology with similar proteins in other staphylococcal species, mnhB2 likely plays a role in ion homeostasis, possibly involving cation exchange such as Na⁺/H⁺ antiport activity.

Antiporter proteins are crucial for bacterial survival in changing environments as they help maintain appropriate intracellular pH, osmolarity, and ion concentrations. In pathogenic bacteria like S. haemolyticus, antiporters may contribute to virulence by enabling adaptation to host environments, including resistance to antimicrobial peptides and survival within phagocytes.

The specific substrates and detailed mechanism of the mnhB2 antiporter remain areas requiring further research, but its characterization as a membrane protein suggests potential roles in cellular processes critical for bacterial adaptation, stress response, and possibly antibiotic resistance.

How does the genomic plasticity of S. haemolyticus affect the expression and function of membrane proteins like mnhB2?

S. haemolyticus displays remarkable genomic plasticity, with numerous insertion sequences (ISs) mediating frequent genomic rearrangements . This plasticity directly impacts the expression and function of membrane proteins like the mnhB2 antiporter subunit through several mechanisms:

First, IS-mediated rearrangements can alter gene expression by repositioning genes relative to promoters or by disrupting regulatory elements. For membrane proteins like mnhB2, this could lead to altered expression levels affecting cellular ion homeostasis and adaptation capabilities . Second, genetic rearrangements and IS element insertions can modify coding sequences, potentially resulting in truncated or chimeric proteins with altered functionality or substrate specificity .

Research has demonstrated that the S. haemolyticus chromosome is highly unstable during serial growth in vitro, with IS1272 transposition events paralleling changes in clinically relevant phenotypic traits including antibiotic susceptibility . For membrane antiporters, these changes could modify efflux capabilities, potentially contributing to antibiotic resistance phenotypes through altered membrane permeability or active efflux.

The extreme genetic flexibility of S. haemolyticus makes studying specific membrane proteins challenging, as their genetic context and expression patterns may vary between strains or even during laboratory cultivation of a single strain . This necessitates careful strain selection and genetic stabilization strategies when conducting functional studies of proteins like mnhB2.

What experimental approaches are most effective for studying the function of the mnhB2 antiporter in S. haemolyticus?

Experimental ApproachApplicationAdvantagesLimitations
Heterologous ExpressionExpression of mnhB2 in E. coli or other model organismsSimplifies protein production; enables functional studies in a controlled genetic backgroundMay not reflect native regulation; potential issues with proper folding
Gene Knockout/KnockdownCreation of mnhB2-deficient S. haemolyticusReveals phenotypic effects of protein absence; establishes physiological relevanceChallenging due to genomic plasticity; potential compensatory mechanisms
Recombinant Plasmid ConstructionControlled expression using vectors like pBT2Enables complementation studies and protein taggingPlasmid stability issues in S. haemolyticus due to recombination frequency
Ion Transport AssaysMeasurement of substrate transport in membrane vesiclesDirectly assesses antiporter function and substrate specificityTechnical challenges; requires pure membrane preparations
Structural BiologyCrystallography or cryo-EM of purified mnhB2Provides mechanistic insights into antiporter functionDifficult to crystallize membrane proteins; requires high purity

When studying mnhB2 in S. haemolyticus, researchers should implement a multi-faceted approach combining genetic manipulation with functional assays . The construction of recombinant plasmids, as demonstrated with other S. haemolyticus genes, can be accomplished using techniques like In-Fusion Cloning with appropriate homologous repeat sequences .

Given the genomic instability of S. haemolyticus, frequent verification of genetic constructs is essential, particularly during serial growth experiments . Additionally, comparative studies with related antiporter proteins from more genetically stable staphylococcal species may provide complementary insights while avoiding some technical challenges specific to S. haemolyticus.

How might recombinant mnhB2 contribute to understanding antibiotic resistance mechanisms in S. haemolyticus?

Recombinant mnhB2 provides a valuable tool for investigating potential links between membrane transport processes and the notorious multidrug resistance of S. haemolyticus. As a putative antiporter subunit, mnhB2 may directly or indirectly contribute to antibiotic resistance through several mechanisms that can be explored using recombinant protein technology.

First, antiporters can contribute to resistance by mediating the efflux of antimicrobial compounds or by maintaining membrane potential necessary for other resistance mechanisms . By expressing recombinant mnhB2 in controlled systems, researchers can assess its substrate specificity and determine if it directly transports antibiotics or ions that affect antibiotic efficacy.

Second, membrane antiporters play crucial roles in pH homeostasis and ion balance, which can modulate bacterial susceptibility to antibiotics . Recombinant mnhB2 expression in antibiotic-sensitive host strains, followed by susceptibility testing, can reveal whether mnhB2 confers resistance to specific antibiotic classes, particularly those affected by transmembrane gradients.

Third, the genomic context of mnhB2 may reveal co-localization with known resistance determinants, suggesting functional relationships . Recombinant expression of mnhB2 along with neighboring genes can help determine if they function together in resistance mechanisms.

S. haemolyticus is known for its early acquisition of resistance to glycopeptide antibiotics, and investigating whether membrane transporters like mnhB2 contribute to this phenotype would address a significant knowledge gap in staphylococcal antibiotic resistance research .

What challenges arise when expressing recombinant S. haemolyticus proteins in heterologous systems?

Expressing recombinant S. haemolyticus proteins, particularly membrane proteins like mnhB2, presents several significant challenges:

First, codon usage bias can affect translation efficiency in heterologous hosts. S. haemolyticus has a high GC content compared to some common expression hosts, potentially necessitating codon optimization for efficient expression . Second, membrane proteins often require specific lipid environments and chaperones for proper folding and function. Heterologous hosts may lack these specific factors, leading to misfolding, aggregation, or non-functional protein .

Third, S. haemolyticus proteins may contain unique post-translational modifications that heterologous systems cannot reproduce, potentially affecting protein function or stability. Additionally, expression of membrane transport proteins can be toxic to host cells if they disrupt membrane potential or homeostasis .

The construction of expression vectors requires careful consideration of promoter strength, fusion tags for purification, and leader sequences. When working with S. haemolyticus genes, researchers have successfully used approaches like amplifying the target gene from genomic DNA and inserting it into vectors such as pBT2 using restriction enzyme digestion and ligation . Including appropriate upstream leader peptide sequences can be crucial for proper expression, as demonstrated by the construction of pBT2-LP-ErmC for another S. haemolyticus protein .

For functional studies, researchers have used S. aureus ATCC25923 as an experimental subject when a standard S. haemolyticus strain was unavailable, highlighting the potential utility of related staphylococcal species as expression hosts .

What purification strategies are most effective for recombinant mnhB2 protein?

Purifying recombinant mnhB2, a membrane protein from S. haemolyticus, requires specialized approaches that preserve protein structure and function. The following methodological strategies have proven effective for similar membrane proteins:

Expression with affinity tags is the foundation of efficient purification, with His-tags being particularly suitable for membrane proteins like mnhB2 . The His-tag allows purification using immobilized metal affinity chromatography (IMAC) under conditions that maintain protein folding. For optimal results, placement of the tag should be determined experimentally, as C-terminal tags may interfere less with function for some antiporters.

Membrane protein solubilization requires careful detergent selection. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often preserve antiporter structure and function better than harsher detergents like SDS. A detergent screening approach is recommended to identify optimal conditions for mnhB2.

For functional studies, reconstitution into proteoliposomes provides a controlled membrane environment. This approach involves incorporating purified mnhB2 into artificial liposomes composed of defined phospholipids, allowing for precise measurement of transport activities with different ion gradients.

Quality assessment through size exclusion chromatography is essential to confirm protein homogeneity and proper folding. For mnhB2, multiple purification steps may be necessary, typically involving IMAC followed by size exclusion chromatography and possibly ion exchange chromatography depending on the sample purity.

The genomic plasticity of S. haemolyticus necessitates sequence verification of the recombinant construct before purification attempts, as genomic rearrangements can occur during cloning procedures .

How can functional transport assays be designed to characterize mnhB2 activity?

Designing functional transport assays for the mnhB2 antiporter requires methods that accurately measure substrate exchange across membranes. Several complementary approaches can be implemented:

Ion-sensitive fluorescent probes provide a powerful tool for real-time monitoring of transport activity. For investigating mnhB2, which likely functions as a cation/proton antiporter, probes such as BCECF for pH changes, SBFI for sodium flux, or Fura-2 for calcium movements can be incorporated into proteoliposomes containing purified recombinant mnhB2 . This allows for kinetic measurements of transport activity under varying conditions.

Radioisotope flux assays offer high sensitivity for quantitative assessment of transport. By loading proteoliposomes or cells expressing mnhB2 with radioisotopes of potential substrates (e.g., ²²Na⁺, ⁴⁵Ca²⁺), researchers can measure substrate exchange rates accurately. This approach is particularly valuable for determining substrate specificity and affinity.

Electrophysiological methods like patch-clamp techniques or solid-supported membrane electrophysiology can directly measure ion currents generated by mnhB2 when exposed to different substrates. These methods provide detailed information about transport kinetics and electrogenicity.

A methodological consideration specific to S. haemolyticus proteins is the impact of genomic instability on expression systems. When designing functional assays, researchers should implement regular genetic verification of expression constructs, as IS element transposition can occur during cultivation and affect the integrity of the mnhB2 gene .

Functional Assay TypeMeasured ParameterAdvantagesTechnical Requirements
Fluorescent Probe AssayspH, ion concentration changesReal-time kinetics; Non-destructiveSpecialized fluorescence equipment; Careful probe calibration
Radioisotope FluxSubstrate transport ratesHigh sensitivity; QuantitativeRadioactivity handling facilities; Scintillation counting
ElectrophysiologyCurrent generationDirect measurement of ion movement; High temporal resolutionSpecialized equipment; Technical expertise
Growth ComplementationFunctional complementationPhysiological relevance; Simpler setupSuitable mutant strains; May lack mechanistic details

What considerations are important when designing primers for cloning S. haemolyticus genes like mnhB2?

Designing effective primers for cloning S. haemolyticus genes presents unique challenges due to the organism's genomic features. Several critical considerations should guide primer design:

First, GC content optimization is essential as S. haemolyticus has regions of high GC content that can complicate PCR amplification . Primers should be designed with balanced GC content (40-60%) and avoid GC-rich regions that might form secondary structures. For challenging regions, addition of PCR enhancers like DMSO (5-10%) or betaine may improve amplification.

Second, avoiding insertion sequence elements is crucial, as S. haemolyticus contains numerous IS elements that can lead to non-specific priming or amplification of unintended regions . Primer design should involve careful sequence analysis to ensure specificity to the target gene region without homology to the abundant IS elements in the genome.

Third, inclusion of restriction sites requires strategic planning. When designing primers for subsequent cloning into vectors like pBT2, restriction sites should be included with appropriate extra bases (3-6 nucleotides) at the 5' end to ensure efficient enzyme digestion . The chosen restriction sites should be absent from the mnhB2 sequence but present in the target vector's multiple cloning site.

For S. haemolyticus genes, researchers have successfully used approaches like adding homologous repeat sequences at both ends of recombinant plasmids to facilitate In-Fusion Cloning . This method can be particularly valuable for mnhB2 cloning, especially when incorporating upstream regulatory elements.

Additionally, when cloning membrane proteins like mnhB2, consideration of the native ribosome binding site and potential leader peptide sequences is important for proper expression . Including a synthetic leader peptide sequence, as demonstrated with the ErmC gene from S. haemolyticus, can enhance expression in recombinant systems .

How might mnhB2 function contribute to S. haemolyticus adaptation in hospital environments?

The putative antiporter subunit mnhB2 likely plays a significant role in S. haemolyticus adaptation to hospital environments through several mechanisms related to membrane transport functions. S. haemolyticus has emerged as a prevalent nosocomial pathogen, with a single highly prevalent genetic lineage (clonal complex CC29) accounting for 91% of isolates disseminated worldwide in hospital settings .

Ion homeostasis mediated by membrane transporters like mnhB2 enables adaptation to various environmental stresses encountered in healthcare settings. Antiporters typically regulate intracellular pH and ion concentrations, allowing bacteria to survive in the presence of disinfectants, antiseptics, and varying pH conditions on hospital surfaces and medical devices . The ability of S. haemolyticus to form biofilms, a key virulence factor in device-related infections, may also be influenced by membrane transporters that maintain appropriate ionic conditions for biofilm formation and stability .

Genomic studies have shown that S. haemolyticus undergoes frequent genomic rearrangements, particularly involving insertion sequence IS1272, which parallels changes in clinically relevant phenotypic traits including biofilm formation and antibiotic susceptibility . These genomic changes likely affect membrane protein expression and function, potentially altering mnhB2 activity to optimize bacterial survival in specific hospital microenvironments.

Future research directions should investigate correlation between mnhB2 sequence variants or expression levels and specific hospital adaptation phenotypes. Additionally, comparing mnhB2 sequences between hospital-adapted CC29 strains and community isolates could reveal adaptation-specific mutations that enhance survival in healthcare settings .

What are the implications of S. haemolyticus genomic plasticity for research on membrane proteins like mnhB2?

The extraordinary genomic plasticity of S. haemolyticus presents significant implications for research on membrane proteins like mnhB2, requiring specialized approaches and careful experimental design.

The presence of numerous insertion sequences (up to 82 IS elements identified in the S. haemolyticus chromosome) creates a highly dynamic genome prone to frequent rearrangements . This genomic instability directly impacts membrane protein research in several ways:

First, strain-to-strain variation in membrane protein sequences may be substantial, necessitating careful selection and characterization of reference strains for mnhB2 studies . Researchers should validate target gene sequences before and after experiments to ensure genetic stability throughout the research process. Second, expression studies must account for potential regulatory changes due to genomic rearrangements that may affect promoter positioning or regulatory element function . Time-course studies should incorporate periodic genetic verification to detect potential IS-mediated changes.

Third, phenotype-genotype correlations become more challenging as the genetic background may change during experiments . This necessitates rigorous control measures when attributing phenotypic changes to specific membrane proteins like mnhB2. Long-term culturing of S. haemolyticus, particularly without selective pressure, has been shown to generate mutants that lose phenotypic traits .

Research ChallengeMethodological ImplicationRecommended Approach
Genetic InstabilitySequence changes during experimentsRegular sequencing verification; Use multiple isolates
Regulatory VariationAltered expression patternsqRT-PCR to monitor expression; Reporter constructs
Functional RedundancyCompensatory mechanismsMultiple gene knockout strategies; Heterologous expression
Reference Strain SelectionStrain-specific variationsGenomic characterization before selection; Multiple strain comparison

Future directions should include comparative studies of mnhB2 across multiple S. haemolyticus isolates to establish conservation patterns and identify genomic context variability . Additionally, researchers should develop genetic stabilization strategies specifically for S. haemolyticus to facilitate more reliable functional studies of membrane proteins.

How does mnhB2 compare structurally and functionally to antiporter subunits in other staphylococcal species?

Comparative analysis of mnhB2 across staphylococcal species provides insights into evolutionary conservation and functional specialization of this membrane antiporter. While specific structural data on mnhB2 is limited in the available literature, broader genomic comparisons of S. haemolyticus with other staphylococci reveal patterns relevant to membrane protein evolution.

S. haemolyticus possesses unique orfs likely involved in bacterial pathogenesis that are not found in other staphylococci . The functional specialization of membrane transporters like mnhB2 may contribute to the specific pathogenic potential and antibiotic resistance profile of S. haemolyticus compared to other staphylococcal species.

Staphylococcal SpeciesAntiporter CharacteristicsEcological NichePotential Functional Specialization
S. haemolyticusHigh genomic plasticity affecting expression; Potentially linked to antibiotic resistanceHuman skin (axillae, perineum, inguinal areas); Hospital environmentsAdaptation to antiseptics; Biofilm formation on medical devices
S. aureusMore stable genomic context; Well-characterized virulence factorsHuman nasal passages; Skin; Diverse environmentsVirulence factor expression; Toxin production
S. epidermidisBiofilm-associated; Less antibiotic resistance than S. haemolyticusHuman skin (widespread); Medical devicesBiofilm formation; Commensalism

Future research should include comparative structural biology approaches to determine if the antiporter architecture of mnhB2 has unique features that contribute to S. haemolyticus' distinctive phenotypic traits, particularly its early acquisition of resistance to glycopeptide antibiotics and its ability to cause device-related infections .

What novel experimental approaches could advance understanding of membrane protein function in the context of S. haemolyticus genomic plasticity?

Investigating membrane protein function in S. haemolyticus requires innovative approaches that account for its exceptional genomic plasticity. Several cutting-edge methodologies offer promising avenues for advancing our understanding of proteins like mnhB2:

CRISPR interference (CRISPRi) systems adapted for S. haemolyticus would enable reversible knockdown of membrane protein expression without permanent genetic modifications . This approach would be particularly valuable for studying essential membrane proteins while minimizing selection for compensatory mutations that often occur with traditional knockout methods in genetically plastic organisms.

Single-cell transcriptomics combined with fluorescent protein tagging could reveal population heterogeneity in membrane protein expression resulting from stochastic genomic rearrangements . This approach would provide insights into how IS-mediated genomic plasticity creates phenotypic diversity within S. haemolyticus populations.

Nanobody-based biosensors developed against specific conformational states of mnhB2 would enable real-time visualization of antiporter activity in living cells . Such sensors could reveal how membrane protein function changes during adaptation to environmental stresses or antibiotic exposure.

Transposon sequencing (Tn-seq) with conditional selection could identify genetic interactions between mnhB2 and other genes under specific environmental conditions . This approach would help map the functional network of membrane transporters in S. haemolyticus and identify potential redundancies or compensatory mechanisms.

Long-read sequencing technologies applied to serial passage experiments would enable tracking of genomic rearrangements affecting membrane protein genes during adaptation . This approach would provide direct evidence of how IS-mediated changes alter the expression and function of proteins like mnhB2 during adaptation to specific environments.

These innovative approaches would address the unique challenges posed by S. haemolyticus while advancing our understanding of how membrane protein function contributes to its success as a hospital-adapted pathogen with remarkable antibiotic resistance capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.