Recombinant Staphylococcus haemolyticus Putative antiporter subunit mnhC2 (mnhc2)

Shipped with Ice Packs
In Stock

Description

Biological Roles in S. haemolyticus

  • Ion Homeostasis: Mnh antiporters counteract cytoplasmic acidification and osmotic stress, critical for survival in hostile environments like human tissue or medical devices .

  • Antibiotic Resistance: While direct evidence linking mnhC2 to resistance is limited, cation/proton antiporters in related species (e.g., S. aureus) mitigate drug-induced stress, suggesting a potential role in tolerance .

  • Pathogenesis: S. haemolyticus antiporters may support persistence in infections by regulating intracellular pH during immune evasion .

Research Applications

Recombinant mnhC2 is primarily used for:

  1. Functional Studies: Investigating ion transport mechanisms and stress response pathways .

  2. Antibody Production: Generating monoclonal or polyclonal antibodies for diagnostic tools .

  3. Structural Analysis: Resolving 3D architecture via X-ray crystallography or cryo-EM (pending full-length protein availability) .

Comparative Analysis with Homologs

The mnhC2 subunit shares functional similarities with homologs in S. aureus:

FeatureS. haemolyticus mnhC2S. aureus Mnh1/Mnh2
Subunit CompositionPart of a seven-subunit complexSeven-subunit complex (Mnh1 and Mnh2)
Catalytic ActivityPresumed Na+/H+ antiportNa+/H+ (Mnh1) and Na+/H+/K+ (Mnh2) antiport
Role in VirulenceHypothesized stress adaptationCritical for halotolerance and murine infection

Unresolved Questions and Research Gaps

  1. Full-Length Structure: Current recombinant variants are partial; full-length protein studies are needed to map functional domains .

  2. Direct Role in Resistance: No studies yet link mnhC2 to S. haemolyticus’s multidrug resistance, unlike IS elements or SCCmec cassettes .

  3. Regulatory Mechanisms: How mnhC2 expression is controlled under stress remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your preferred format in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend reaching out to your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes a final concentration of 50% glycerol, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain their quality for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To prevent degradation, aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development and implementation.
Synonyms
mnhC2; mrpC2; SH2273; Putative antiporter subunit mnhC2; Mrp complex subunit C2; Putative NADH-ubiquinone oxidoreductase subunit mnhC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhC2
Target Protein Sequence
MNLILLLVIGFLVFIGTYMILSLNLIRIVIGISIYTHAGNLIIMSMGHYSNKMTEPLIHG SNTNYVDPLLQAIVLTAIVIGFAMTAFLLVLVYRTYRVTKEANIDVLRGEEDENEQ
Uniprot No.

Target Background

Database Links

KEGG: sha:SH2273

STRING: 279808.SH2273

Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative function of the mnhC2 antiporter subunit in Staphylococcus haemolyticus?

The mnhC2 putative antiporter subunit in S. haemolyticus is believed to be involved in ion transport across the bacterial membrane. While specific experimental data on mnhC2 is limited, antiporter systems in staphylococci typically participate in pH homeostasis, osmotic regulation, and potentially antibiotic resistance mechanisms. To investigate its function, researchers should consider:

  • Performing sequence homology analysis with known antiporter proteins

  • Conducting gene knockout studies to observe phenotypic changes

  • Measuring ion transport in membrane vesicles with and without the protein

  • Using fluorescent probes to monitor changes in membrane potential or ion concentrations

Based on genomic analyses of S. haemolyticus, this protein may contribute to the organism's remarkable adaptability to hospital environments and possibly its antimicrobial resistance profile .

How does mnhC2 expression differ between clinical and commensal Staphylococcus haemolyticus isolates?

Expression patterns of membrane proteins like mnhC2 may vary significantly between clinical and commensal isolates. Comparative genomic analyses have revealed distinct genetic signatures between these two groups of S. haemolyticus isolates . Researchers investigating expression differences should:

  • Design RT-qPCR experiments targeting mnhC2 mRNA in both isolate types

  • Perform Western blot analysis using antibodies against the recombinant protein

  • Conduct RNA-seq to examine differential gene expression patterns

  • Compare expression under various environmental conditions mimicking hospital settings versus skin commensalism

Current research indicates 88% of clinical S. haemolyticus isolates show multi-drug resistance compared to only 11% of commensal isolates, suggesting differential expression or functionality of membrane components like antiporter systems may contribute to this phenotype .

What role might the mnhC2 antiporter play in antibiotic resistance mechanisms of clinical S. haemolyticus isolates?

The potential contribution of mnhC2 to antibiotic resistance in S. haemolyticus represents an important research question. Clinical isolates of S. haemolyticus display high levels of antimicrobial resistance, with 87% showing methicillin resistance and 75% exhibiting multi-drug resistance . To investigate mnhC2's role:

  • Create isogenic mutants with mnhC2 deletions and assess changes in MIC values

  • Perform antibiotic susceptibility testing under varying ion concentrations

  • Measure efflux activity in the presence of specific inhibitors

  • Conduct structural modeling to identify potential antibiotic binding sites

Studies should account for the genetic background of isolates, as S. haemolyticus strains show high diversity in pulsotype analysis and varying SCCmec element distribution (predominantly type V) .

How does the structure and function of mnhC2 contribute to S. haemolyticus adaptation in hospital environments?

Hospital adaptation of S. haemolyticus involves complex mechanisms, potentially including membrane transporters like mnhC2. The species shows specific signatures associated with successful hospital adaptation, including biofilm formation capabilities and resistance to multiple antibiotics . To examine mnhC2's contribution:

  • Compare protein expression under hospital-mimicking conditions (antiseptics, varying pH)

  • Analyze protein-protein interactions between mnhC2 and other membrane components

  • Examine co-evolution of mnhC2 with other hospital adaptation factors

  • Perform site-directed mutagenesis to identify critical functional domains

Research should consider that clinical S. haemolyticus isolates often harbor genetic elements not commonly found in commensal isolates, such as homologs of serine-rich repeat glycoproteins (sraP) and novel capsular polysaccharide operons .

How should researchers design experiments to study the physiological role of mnhC2 in various S. haemolyticus strains?

When designing experiments to investigate mnhC2 function, researchers must carefully consider variable selection and control. Following proper experimental design principles:

Independent Variables:

  • Strain type (clinical vs. commensal isolates)

  • Growth conditions (pH, ion concentrations, antibiotic presence)

  • Expression levels of mnhC2 (native, overexpression, knockout)

Dependent Variables:

  • Growth rates

  • Membrane potential

  • Ion transport rates

  • Antibiotic susceptibility

Control of Extraneous Variables:

  • Standardize media composition and growth conditions

  • Use isogenic strains differing only in mnhC2 expression

  • Include appropriate control strains (e.g., reference S. haemolyticus strains)

A true experimental design with random assignment of bacterial cultures to treatment conditions will yield the most reliable results . Consider using a factorial design to examine interactions between variables, particularly when studying environmental factors that might influence mnhC2 function.

What are the key considerations when designing comparative genomic studies to investigate mnhC2 variants across S. haemolyticus populations?

Comparative genomic studies of mnhC2 require careful planning to generate meaningful data. Based on current research approaches:

  • Sample Selection Strategy:

    • Include both clinical isolates (from various infection sites) and commensal isolates

    • Consider geographical diversity to capture potential regional variations

    • Include historical isolates when available to examine temporal changes

  • Sequencing Approach:

    • Whole genome sequencing provides context for mnhC2 analysis

    • Targeted sequencing of mnhC2 and flanking regions allows deeper coverage

    • Long-read sequencing helps resolve structural variations

  • Bioinformatic Analysis Pipeline:

    • Multiple sequence alignment of mnhC2 variants

    • Phylogenetic reconstruction to determine evolutionary relationships

    • Identification of selection pressures using dN/dS ratios

    • Analysis of mobile genetic elements near mnhC2

Prior studies have successfully used such approaches to identify distinct clades of S. haemolyticus with different distributions of clinical and commensal isolates , suggesting similar techniques would be valuable for focused mnhC2 analysis.

What protein purification techniques are most effective for recombinant S. haemolyticus mnhC2 antiporter subunit?

Purification of recombinant membrane proteins like mnhC2 presents significant challenges. A methodological approach should include:

  • Expression System Selection:

    • E. coli-based systems (BL21(DE3), C41/C43 for membrane proteins)

    • Cell-free expression systems for potentially toxic membrane proteins

    • Consideration of codon optimization for S. haemolyticus genes

  • Solubilization and Extraction:

    • Detergent screening (DDM, LDAO, Triton X-100)

    • Native nanodiscs or SMALPs for maintaining native lipid environment

    • Inclusion body recovery and refolding if necessary

  • Purification Steps:

    • Affinity chromatography (His-tag, GST-tag)

    • Size exclusion chromatography

    • Ion exchange chromatography

  • Quality Control:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism to assess secondary structure

    • Functional assays (e.g., liposome reconstitution)

Partial constructs of mnhC2 may require special consideration, as commercial reagents have included "partial" versions of this protein , potentially reflecting difficulties in expressing the full-length protein.

How can researchers effectively measure the ion transport activity of recombinant mnhC2 in experimental systems?

Measuring antiporter activity requires specialized techniques adapted to membrane proteins. A comprehensive methodological approach includes:

  • Reconstitution Systems:

    • Proteoliposomes with defined lipid composition

    • Black lipid membranes for electrophysiology

    • Whole-cell assays with mnhC2-deficient strains complemented with recombinant protein

  • Transport Measurement Techniques:

    • Fluorescent ion indicators (BCECF for pH, SBFI for Na+)

    • Radioactive ion flux assays (22Na+, 45Ca2+)

    • Patch-clamp electrophysiology

    • Solid-supported membrane electrophysiology

  • Experimental Variables to Consider:

    • pH gradients

    • Ion concentration gradients

    • Membrane potential effects

    • Temperature dependence

  • Data Analysis:

    • Initial rate calculations

    • Kinetic modeling (Michaelis-Menten, Hill equation)

    • Comparison with known antiporter systems

These techniques provide complementary information about transport mechanism, substrate specificity, and kinetic parameters of the mnhC2 antiporter subunit.

How should researchers analyze contradictory findings when comparing mnhC2 function in different S. haemolyticus strains?

When faced with contradictory results across different S. haemolyticus strains, researchers should:

  • Consider Strain Diversity:

    • Phylogenetic placement of the strains (S. haemolyticus shows high genetic diversity)

    • Presence of different mobile genetic elements that might affect phenotype

    • Clinical versus commensal origin (clear segregation observed in genomic studies)

  • Statistical Approaches:

    • Stratified analysis controlling for strain characteristics

    • Three-way contingency tables with Mantel-Haenszel methods

    • Mixed-effects models incorporating strain as a random effect

  • Experimental Validation:

    • Cross-complementation experiments between strains

    • Site-directed mutagenesis to identify critical sequence differences

    • Creation of chimeric proteins to isolate functional domains

  • Data Presentation:

    Strain TypeOriginmnhC2 VariantAntibiotic ResistanceTransport Activity
    Clinical 1BloodVariant AMulti-resistantHigh (0.87±0.12)
    Clinical 2CatheterVariant BMethicillin-resistantMedium (0.54±0.09)
    Commensal 1SkinVariant CSusceptibleLow (0.23±0.08)

This approach acknowledges that S. haemolyticus isolates display significant phenotypic and genotypic heterogeneity , which might explain seemingly contradictory findings.

What bioinformatic approaches can effectively predict mnhC2 structure-function relationships in the absence of crystal structures?

In the absence of experimental structures, computational approaches can provide valuable insights into mnhC2 structure and function:

  • Homology Modeling:

    • Identify suitable templates from related antiporter proteins

    • Build multiple models based on different templates

    • Evaluate model quality using QMEAN, ProQ, and Ramachandran plots

  • Molecular Dynamics Simulations:

    • Simulate protein behavior in membrane environments

    • Evaluate ion binding sites and transport pathways

    • Predict effects of mutations on protein stability and function

  • Evolutionary Analysis:

    • Identify conserved residues across antiporter families

    • Detect co-evolving residues that may interact functionally

    • Calculate selection pressures on different protein domains

  • Machine Learning Approaches:

    • Predict functional sites using neural networks

    • Classify variants based on predicted impact on function

    • Integrate multiple sequence-based features for functional prediction

These approaches should be validated where possible with experimental data, even if limited to indirect functional assays or mutagenesis studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.