Recombinant Staphylococcus haemolyticus Putative antiporter subunit mnhE2 (mnhE2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mnhE2; mrpE2; SH2271; Putative antiporter subunit mnhE2; Mrp complex subunit E2; Putative NADH-ubiquinone oxidoreductase subunit mnhE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhE2
Target Protein Sequence
MRQVVLNILIAFLWVLFQDEDSFQFSTFVSGFIIGLIVIYILHRFFGQAFYPKKIWIAIK FLGVYLYQLITSSISIINYILFKTRHMNPGLLTYETNLKNDWAITFLTILIIITPGSTVI RISKTTNKFFIHSIDVSEKEKESLLKSIKQYENLITEVSQ
Uniprot No.

Target Background

Database Links

KEGG: sha:SH2271

STRING: 279808.SH2271

Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What purification methodologies are recommended for obtaining high-quality recombinant mnhE2 protein?

For optimal purification of recombinant mnhE2 protein:

  • Affinity Chromatography: Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC) with Ni-NTA resins. Optimize imidazole concentration in binding and elution buffers to minimize non-specific binding while maximizing target protein recovery.

  • Buffer Composition: Maintain protein stability by including appropriate detergents (e.g., n-dodecyl-β-D-maltoside or LMNG) in all purification buffers to preserve the native structure of this membrane protein.

  • Post-Purification Processing: Following elution, consider buffer exchange to remove imidazole and concentrate the protein using centrifugal filters with appropriate molecular weight cut-offs.

  • Storage and Reconstitution: Store the purified protein as lyophilized powder. For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding glycerol (typically to a final concentration of 50%) for long-term storage stability at -20°C/-80°C .

  • Quality Assessment: Verify purity using SDS-PAGE (expected >90% purity) and assess structural integrity via circular dichroism or limited proteolysis before proceeding with functional studies.

How do mutations in conserved residues affect the conformational dynamics of the Mrp antiporter complex?

Mutations in conserved residues significantly impact the conformational dynamics of the Mrp antiporter complex, particularly affecting its proton-conducting function. Molecular dynamics (MD) simulations and site-directed mutagenesis studies have revealed that point mutations directly influence transport activity by altering the conformational dynamics of key residues .

A critical finding is how mutations affect the histidine molecular switch mechanism. In the MrpA subunit, histidine 248 (H248) acts as a molecular switch with two distinct conformational states (A and B). Mutations in residues that interact with H248 significantly impact these conformational states:

  • T306V mutation: Eliminates the population of the A conformation of H248, impairing antiport function by altering proton transfer pathways from the periplasmic side .

  • S146A/T mutations: Cause loss of the B conformation, with S146A showing a complete drop in occupancy from 40% to zero, corresponding with decreased sodium tolerance in functional assays .

  • L247H mutation: Eliminates the B conformation entirely, resulting in loss of sodium tolerance and partial dequenching in experimental analysis .

This table summarizes the effects of key mutations on H248 conformational states and antiporter function:

MutationEffect on H248 ConformationFunctional Impact
T306VLoss of A conformationImpaired antiport function
S146ALoss of B conformation (0% occupancy)Decreased sodium tolerance
S146TLoss of B conformationDecreased sodium tolerance
A250VMaintains both A and B states (26% and 52%)Wild-type-like behavior
W232AReduced but present A and B conformationsWild-type-like behavior
S249AReduced but present A and B conformationsWild-type-like behavior

These findings demonstrate that the ability of histidine to adopt different conformational states is crucial for antiporter function, with mutations disrupting hydrogen bonding networks and altering the dynamics of this molecular switch .

What methodological approaches are most effective for characterizing the proton-conducting pathways in the Mrp antiporter?

Characterizing proton-conducting pathways in the Mrp antiporter requires a multi-faceted methodological approach combining computational, structural, and functional techniques:

  • Large-Scale Atomistic Molecular Dynamics Simulations:

    • Simulate the antiporter in different protonation states to track conformational changes

    • Model water dynamics within potential proton channels

    • Evaluate the energetics of proton movement through calculated potential of mean force (PMF)

  • Site-Directed Mutagenesis:

    • Systematically mutate conserved polar residues (particularly histidines, lysines, and acidic residues)

    • Design mutations that emulate disease-related variants from homologous proteins

    • Create conservative and non-conservative substitutions to analyze hydrogen-bonding networks

  • Functional Assays:

    • Measure sodium tolerance in growth assays under challenging pH conditions

    • Employ fluorescence-based proton flux assays with pH-sensitive dyes

    • Conduct electrophysiological measurements in reconstituted systems

  • Cryo-EM in Different Conditions:

    • Perform structural analysis at varying pH values to trap different conformational states

    • Image mutant variants showing altered function to correlate structure with activity

    • Combine with nanodiscs or amphipol technology to maintain native-like lipid environments

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map solvent-accessible regions and conformational flexibility

    • Identify regions undergoing significant conformational changes during ion transport

The integration of these approaches has revealed that the histidine switch mechanism involving H248 is central to proton translocation, with specific conformational states (A and B) differentially stabilized based on the protonation states of key residues like K299 and the K223/E140 pair .

How does the histidine molecular switch mechanism in the Mrp antiporter compare with other proton-translocating enzymes?

The histidine molecular switch mechanism in Mrp antiporters represents a distinct yet conceptually related approach to proton translocation compared to other enzymes. Based on the available research, the following comparisons can be drawn:

  • Similarity to Respiratory Complex I:

    • The Mrp antiporter's histidine switch shares homology with mitochondrial respiratory complex I

    • Both systems utilize conformationally mobile histidine residues as key elements for directional proton movement

    • The histidine (H248) in MrpA adopts discrete conformational states (A and B) that gate proton transfer pathways

  • Distinction from F₁F₀-ATP Synthase:

    • While F₁F₀-ATP synthase utilizes a rotary mechanism coupled to proton translocation through a c-ring

    • Mrp antiporters employ a reciprocating conformational change in the histidine switch without large-scale rotary movements

    • Both mechanisms ensure unidirectional proton movement but through fundamentally different structural arrangements

  • Comparison to Bacteriorhodopsin:

    • Bacteriorhodopsin uses light energy to drive a sequence of protonation changes in key residues

    • The Mrp histidine switch is driven by changes in charge and protonation states that reorganize hydrogen bonding networks

    • Both mechanisms feature water molecules as part of the proton relay system

The Mrp antiporter's histidine switch mechanism is characterized by:

  • Charge-driven conformational changes

  • Coupled sidechain and backbone conformational shifts

  • Hydration changes in the protein interior

  • A fail-safe directional gating system that prevents short-circuiting

This mechanism ensures efficient proton translocation against membrane gradients, with the histidine switch functioning as a central element for controlling proton movement directionality - a feature critical for energy-transducing membrane proteins.

What is the potential relationship between mnhE2 function and antibiotic resistance in Staphylococcus haemolyticus?

The relationship between mnhE2 function and antibiotic resistance in Staphylococcus haemolyticus presents a complex and potentially significant research area, with several mechanistic connections:

  • pH Homeostasis and Antibiotic Efficacy:

    • The Mrp antiporter complex, including mnhE2, is crucial for maintaining pH homeostasis in bacteria

    • Many antibiotics show pH-dependent efficacy, with altered intracellular pH potentially reducing their activity

    • Proper functioning of mnhE2 within the Mrp antiporter may indirectly modulate antibiotic susceptibility by maintaining optimal intracellular pH

  • Connection to Multidrug Resistance:

    • S. haemolyticus clinical isolates show high rates of multidrug resistance (88% of clinical isolates versus 11% of commensal isolates)

    • Ion homeostasis systems like Mrp antiporters can affect membrane potential, which in turn influences the activity of certain antibiotic efflux pumps

    • Altered expression or function of mnhE2 might contribute to adaptive responses affecting drug accumulation

  • Environmental Adaptation:

    • S. haemolyticus strains adapted to hospital environments show specific genomic signatures

    • Mrp antiporters are critical for bacterial adaptation to challenging conditions like high salt or alkaline environments

    • The ability to maintain ion homeostasis through mnhE2 function may support survival under antibiotic selection pressure

  • Potential Therapeutic Target:

    • Inhibition of mnhE2 function could potentially sensitize resistant S. haemolyticus to certain antibiotics

    • The histidine switch mechanism in the Mrp complex represents a novel target for antibiotic development

    • The evolutionary conservation of key functional elements in the Mrp antiporter suggests inhibitors might have broad-spectrum activity

What are the optimal conditions for functional characterization of recombinant mnhE2 protein?

For optimal functional characterization of recombinant mnhE2 protein, researchers should consider the following experimental parameters and approaches:

  • Reconstitution System Selection:

    • Proteoliposomes: Reconstitute purified mnhE2 into liposomes composed of E. coli polar lipids or synthetic lipid mixtures matching bacterial membrane composition

    • Nanodiscs: Consider MSP-based nanodiscs for a more native-like membrane environment with defined size

    • Continuous membrane systems: GUVs (Giant Unilamellar Vesicles) may be appropriate for certain fluorescence-based assays

  • Buffer and pH Conditions:

    • Test multiple pH ranges (pH 6.0-9.0) to assess pH-dependent activity

    • Include physiologically relevant concentrations of Na+ (typically 100-300 mM) and K+ (typically 100-150 mM)

    • Consider adding Mg2+ (1-5 mM) to stabilize the protein structure

  • Assay Methods for Transport Activity:

    • pH-sensitive fluorescent dyes (BCECF, pyranine) to monitor ΔpH across membranes

    • 22Na+ uptake assays for direct measurement of sodium transport

    • Stopped-flow fluorescence spectroscopy for kinetic measurements

    • Solid-supported membrane (SSM)-based electrophysiology for direct electrical measurements

  • Experimental Controls:

    • Include inactive mutants as negative controls

    • Test mnhE2 alongside other Mrp complex subunits to assess cooperative effects

    • Employ ionophores (monensin, CCCP) as positive controls for membrane permeabilization

  • Data Analysis Parameters:

    • Calculate initial rates of transport under varying substrate concentrations

    • Determine Km and Vmax values for both Na+ and H+ transport

    • Assess the effects of membrane potential using valinomycin-induced K+ diffusion potentials

For reliable results, express the protein with the complete amino acid sequence (1-160) and consider the role of the His-tag in potentially affecting function, with parallel experiments using tag-cleaved protein preparations when possible .

How can researchers effectively investigate the interaction between mnhE2 and other components of the Mrp antiporter complex?

Investigating interactions between mnhE2 and other components of the Mrp antiporter complex requires a strategic combination of biochemical, biophysical, and computational approaches:

  • Co-purification and Co-immunoprecipitation:

    • Express mnhE2 with affinity-tagged partner subunits

    • Perform pull-down assays to identify stable interactions

    • Analyze co-purifying proteins by mass spectrometry to identify interaction partners

    • Cross-linking coupled with mass spectrometry (XL-MS) to map interaction interfaces

  • Biophysical Interaction Analysis:

    • Microscale thermophoresis (MST) to measure binding affinities between purified components

    • Surface plasmon resonance (SPR) for real-time interaction kinetics

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

    • Fluorescence resonance energy transfer (FRET) using labeled protein components to assess proximity in reconstituted systems

  • Structural Biology Approaches:

    • Cryo-electron microscopy of the intact complex to visualize the position of mnhE2

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify protected regions at interfaces

    • NMR spectroscopy of isotopically labeled mnhE2 in the presence of partner proteins

  • Functional Complementation Studies:

    • Create mnhE2 knockout mutants and assess restoration of function with wild-type or mutant versions

    • Perform functional assays in the presence or absence of other Mrp complex components

    • Analyze proton transport activity in reconstituted systems with varying subunit compositions

  • Computational Modeling:

    • Molecular dynamics simulations of mnhE2 within the complete Mrp complex

    • Protein-protein docking to predict interaction interfaces

    • Evolutionary coupling analysis to identify co-evolving residues between subunits

This multifaceted approach allows researchers to build a comprehensive understanding of how mnhE2 integrates structurally and functionally within the Mrp antiporter complex, particularly focusing on interactions that may influence the histidine switch mechanism central to proton translocation .

How might the conformational dynamics of mnhE2 be leveraged for the development of novel antimicrobial strategies?

The conformational dynamics of mnhE2 within the Mrp antiporter complex present promising opportunities for novel antimicrobial development strategies:

  • Structure-Based Inhibitor Design:

    • Target the histidine switch mechanism by developing small molecules that lock H248 in nonproductive conformations

    • Design peptidomimetics that disrupt critical hydrogen bonding networks between conserved residues

    • Develop allosteric inhibitors that bind to interfaces between mnhE2 and other Mrp complex subunits

  • Exploiting Bacterial Adaptation Mechanisms:

    • Clinical isolates of S. haemolyticus show high rates of multidrug resistance (88%) compared to commensal isolates (11%)

    • The Mrp antiporter is critical for bacterial adaptation to challenging environments

    • Inhibiting mnhE2 function could potentially compromise the bacterium's ability to survive in hospital environments

  • Combination Therapy Approaches:

    • Pair conventional antibiotics with Mrp antiporter inhibitors to enhance efficacy

    • Target multiple ion homeostasis systems simultaneously to prevent compensatory mechanisms

    • Exploit pH-dependent antibiotic activities by disrupting bacterial pH regulation via mnhE2 inhibition

  • Rational Mutation Design:

    • Mutations like T306V and S146A significantly impact antiporter function by disrupting H248 conformational dynamics

    • Identify equivalent "weak points" in the conformational mechanism that could be targeted by inhibitors

    • Screen for compounds that mimic the structural effects of these function-disrupting mutations

  • Translational Research Potential:

    • The Mrp antiporter complex shares homology with respiratory complex I

    • Strategies targeting mnhE2 may provide insights for developing treatments for mitochondrial disorders

    • The conservation of the histidine switch mechanism suggests broad applicability across multiple bacterial species

The current understanding of mnhE2's conformational dynamics, particularly the histidine switch mechanism, provides a scientifically grounded foundation for rational drug design approaches targeting this essential component of bacterial ion homeostasis.

What are the implications of recent findings about the histidine switch mechanism for understanding respiratory complex I function?

Recent discoveries about the histidine switch mechanism in the Mrp antiporter have significant implications for understanding respiratory complex I function, potentially resolving longstanding questions about energy transduction:

  • Evolutionary Relationship and Structural Parallels:

    • Several subunits of the Mrp antiporter complex are closely related to membrane-bound subunits of mitochondrial respiratory complex I

    • The Mrp antiporter serves as a simpler model system for studying the more complex mechanisms in respiratory complex I

    • The conservation of key functional elements suggests shared mechanistic principles for proton translocation

  • Mechanistic Insights from the Histidine Switch:

    • The histidine switch mechanism identified in the Mrp antiporter may explain how proton pumping occurs in complex I

    • Charge-driven conformational changes in conserved histidine residues create a gating system ensuring directional proton movement

    • The coupled sidechain and backbone conformational changes provide a molecular basis for long-range energy coupling in complex I

  • Implications for Disease-Related Mutations:

    • Many mitochondrial diseases involve mutations in complex I

    • Understanding how mutations perturb the histidine switch mechanism in the Mrp antiporter provides a framework for interpreting pathogenic mutations in complex I

    • The study showed that specific mutations emulating mitochondrial disease mutations affect conformational dynamics of the histidine switch

  • Novel Experimental Approaches:

    • The research suggests that cryo-EM experiments performed at low pH might trap histidine residues in unique intermediate positions

    • This approach could reveal novel proton transfer routes in both the Mrp antiporter and respiratory complex I

    • The combination of site-directed mutagenesis with large-scale MD simulations represents a powerful methodology for investigating complex I mechanism

  • Proposed Model Integration:

    • The histidine switch model provides a specific molecular mechanism that can be integrated with existing models of complex I function

    • The detailed mechanism explains how charge translocation directionality is maintained against a membrane gradient

    • Understanding of water dynamics within hydrophilic cavities provides insight into proton transfer pathways in both proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.