Recombinant Staphylococcus haemolyticus Putative antiporter subunit mnhF2 (mnhF2)

Shipped with Ice Packs
In Stock

Description

Protein Structure

The mnhF2 protein is a 100–171 amino acid polypeptide (depending on the strain) with a predicted α-helical structure. While no experimental crystallographic data exist, computational models (e.g., AlphaFold DB) suggest high structural confidence (pLDDT >90) for homologs in Staphylococcus aureus . Key features include:

  • N-terminal His-tag: Enables purification via chromatography .

  • Transmembrane domains: Predicted to form ion channels, facilitating cation exchange across membranes .

Proposed Function

mnhF2 is a component of the Mrp (multiple resistance and pH regulation) complex, which mediates Na⁺/H⁺ antiport activity. This system is essential for:

  • pH homeostasis: Neutralizing acidic environments in host tissues .

  • Antibiotic resistance: Contributing to multidrug resistance (MDR) phenotypes, particularly in hospital-associated strains .

  • Osmoregulation: Maintaining cellular integrity under osmotic stress .

Gene and Expression

ParameterValue
Gene IDmnhF2 (UniProt: Q4L448 for S. haemolyticus)
OperonPart of the mrp operon, encoding Na⁺/H⁺ antiporter subunits
Expression HostE. coli
Purification TagN-terminal His-tag

Genomic Plasticity

S. haemolyticus exhibits high genomic instability due to insertion sequences (IS1272) and horizontal gene transfer (HGT), which drives clonal diversification and adaptation to hospital environments . The mrp operon’s variability may contribute to strain-specific resistance and virulence .

Key Studies

FocusDetails
Hospital AdaptationRecombination and IS transposition enable rapid evolution of MDR clones .
SCCmec ElementsSCCmec Type II and V are prevalent in commensal and clinical isolates, linked to methicillin resistance .
ELISA DevelopmentRecombinant mnhF2 is used in immunoassays to detect host antibodies .

Role in Bacterial Pathogenicity

  • Antibiotic resistance: The Mrp complex may enhance resistance to β-lactams and other antibiotics by altering membrane potential .

  • Biofilm formation: Ion homeostasis via mnhF2 could support surface colonization and biofilm persistence .

Future Directions

  1. Structural Validation: Experimental determination of mnhF2’s 3D structure to confirm antiporter activity.

  2. Therapeutic Targets: Exploring mnhF2 as a target for disrupting Na⁺/H⁺ homeostasis in MDR S. haemolyticus.

  3. Diagnostic Markers: Leveraging ELISA kits for rapid detection of anti-mnhF2 antibodies in clinical samples .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, we recommend contacting your local distributors.
As a standard practice, all our proteins are shipped with regular blue ice packs. Should you require shipping with dry ice, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
During the production process, the tag type will be determined. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
mnhF2; mrpF2; SH2270; Putative antiporter subunit mnhF2; Mrp complex subunit F2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhF2
Target Protein Sequence
MIETLTNFFITSALVLFGIAFIIGLFRLIKGPTTADRVVAFDASSAVIMCIIGIVSVIYN TVSFLDSIMLVAIISFVSSVSISRFIGGGRVFNGTNKRNH
Uniprot No.

Target Background

Database Links

KEGG: sha:SH2270

STRING: 279808.SH2270

Protein Families
CPA3 antiporters (TC 2.A.63) subunit F family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus haemolyticus and why is it significant in clinical research?

Staphylococcus haemolyticus is the second most commonly isolated coagulase-negative staphylococcal (CoNS) species alongside Staphylococcus epidermidis. It is an emerging pathogen of nosocomial infections that particularly affects immunocompromised patients, primarily manifesting as bloodstream and device-associated infections . The clinical significance of S. haemolyticus stems from its ranking as the most antibiotic-resistant species among CoNS, which severely limits antibiotic therapy options . It is frequently found as a skin commensal in areas rich in apocrine glands such as axillary and pubic regions, and has been isolated from both humans and companion animals, suggesting potential zoonotic transmission .

What are the primary genetic characteristics of S. haemolyticus relevant to mnhF2 research?

S. haemolyticus possesses a relatively large oriC environ compared to other staphylococcal species, containing multiple coding sequences for potential virulence factors including surface adhesins and capsular polysaccharides . The genome of S. haemolyticus is characterized by significant genetic plasticity due to the presence of numerous insertion sequences (IS), ranging from 15 to 88 per isolate, with ISSha1 and IS1272 found in multiple copies across all isolates . This genomic flexibility likely facilitates adaptation to environmental pressures and may influence the expression and function of membrane proteins like the mnhF2 antiporter subunit. The core genome of S. haemolyticus is slightly smaller than other staphylococcal species, which could be explained by the higher number of unique genes in commensal isolates .

How do antiporter systems typically function in bacterial physiology?

Bacterial antiporters are membrane transport proteins that exchange one solute or ion for another across the cell membrane, playing crucial roles in maintaining cellular homeostasis. In staphylococcal species, antiporter systems like the mnh family often participate in:

  • pH homeostasis - by exchanging protons for cations like Na⁺ or K⁺

  • Osmotic regulation - managing the internal ionic environment in response to external changes

  • Energy conservation - utilizing ion gradients to drive secondary active transport

  • Antimicrobial resistance - some antiporters may contribute to resistance by pumping out toxic compounds or maintaining the proton-motive force under stress

The putative antiporter subunit mnhF2 likely functions as part of a multi-component transport system involved in these processes, potentially contributing to the organism's ability to survive in diverse environments and resist antimicrobial agents.

What does the current literature indicate about phenotypic variations in S. haemolyticus?

Current literature describes significant phenotypic variations in S. haemolyticus, including a mucoid phenotype that represents a deviation from the classical morphology . These mucoid isolates are associated with increased virulence and multi-drug resistance compared to classical morphotypes . Biofilm formation capability varies among S. haemolyticus isolates and has been suggested as an important virulence determinant . Phenotypic rearrangements occur frequently in S. haemolyticus due to the large number of insertion sequences, which may affect the expression of various proteins including membrane transporters like mnhF2 . Production of phenol-soluble modulins has also been identified as a potential virulence factor, although these traits have not been explicitly linked to strains of clinical origin .

What are the recommended protocols for recombinant expression of S. haemolyticus membrane proteins like mnhF2?

For the recombinant expression of S. haemolyticus membrane proteins like mnhF2, researchers should consider the following methodological approach:

  • Gene isolation and vector construction:

    • Amplify the mnhF2 gene using PCR with high-fidelity polymerase

    • Design primers with appropriate restriction sites based on the S. haemolyticus genome sequence

    • Clone the gene into an expression vector containing a suitable promoter (e.g., T7) and affinity tag (e.g., His-tag)

  • Expression system selection:

    • For initial expression trials, use E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Consider cell-free expression systems for difficult-to-express membrane proteins

    • Alternative hosts like Lactococcus lactis or Bacillus subtilis may provide a more suitable environment for staphylococcal proteins

  • Optimization strategies:

    • Test expression at lower temperatures (16-25°C) to reduce inclusion body formation

    • Evaluate induction conditions (IPTG concentration, induction time)

    • Consider fusion partners that enhance membrane protein expression (e.g., MBP, SUMO)

  • Membrane protein extraction and purification:

    • Use mild detergents (DDM, LMNG, or DMNG) for extraction from membranes

    • Implement two-step purification using affinity chromatography followed by size exclusion chromatography

    • Verify protein integrity using SDS-PAGE and Western blotting

The successful expression of functional mnhF2 will likely require iterative optimization of these parameters based on protein yield and activity assessments.

How can researchers differentiate between hospital-adapted and commensal strains of S. haemolyticus for mnhF2 studies?

Researchers can effectively differentiate between hospital-adapted and commensal strains of S. haemolyticus using a multi-faceted approach:

Molecular markers:

  • Screen for IS256 elements, which are found almost exclusively in clinical isolates (86% of clinical vs. 11% of commensal isolates)

  • Identify the presence of transposon Tn552/IS481, predominantly found in clinical isolates (72% of clinical vs. 13% of commensal isolates)

  • Examine for specific phage elements, particularly staphylococcal phage vB_Saus_phi2, found exclusively in clinical isolates

Antibiotic resistance profiling:

  • Test for multi-drug resistance, present in 88% of clinical isolates compared to only 11% of commensal isolates

  • Specifically screen for mecA (oxacillin resistance) and aacA-aphD (aminoglycoside resistance) genes, which strongly indicate invasive isolates

  • Analyze the presence of folB/folP variants which show distinct conserved differences between clinical and commensal isolates

Surface and virulence gene assessment:

  • Check for the presence of SraP homologs (serine-rich repeat glycoproteins) commonly found in clinical isolates

  • Examine for novel capsular polysaccharide operons associated with virulence

  • Test for biofilm formation capability, which combined with antibiotic resistance strongly indicates an invasive isolate

Antiseptic resistance gene analysis:

  • Screen for qacA, which is more common in clinical isolates (65%) compared to commensal isolates (39%)

  • Check for qacB, which is almost exclusive to commensal isolates

This comprehensive approach will provide a clear distinction between hospital-adapted and commensal strains, allowing for more targeted analysis of mnhF2 expression and function in different S. haemolyticus populations.

What are the state-of-the-art methods for analyzing mnhF2 antiporter function?

The functional analysis of mnhF2 antiporter activity requires sophisticated methodological approaches:

Transport activity assays:

  • Fluorescence-based methods:

    • Utilize pH-sensitive fluorescent probes (BCECF, pHluorin) to measure intracellular pH changes in real-time

    • Employ ion-selective fluorescent indicators for direct measurement of cation transport

    • Develop FRET-based sensors for conformational changes during transport cycles

  • Electrophysiological approaches:

    • Patch-clamp recordings of mnhF2-reconstituted proteoliposomes

    • Solid-supported membrane (SSM)-based electrophysiology for measuring transient currents

    • Whole-cell recording of mnhF2-expressing cells under varying ionic conditions

  • Isotope flux measurements:

    • Radioactive isotope (²²Na⁺, ⁴⁵Ca²⁺) flux assays in reconstituted proteoliposomes

    • Competition assays with non-radioactive ions to determine substrate specificity

Structural studies:

  • Cryo-electron microscopy:

    • Single-particle analysis of purified mnhF2 in detergent or lipid nanodiscs

    • Tomography of membrane-reconstituted mnhF2 to visualize native conformation

  • Structural dynamics:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy

Computational approaches:

  • Molecular dynamics simulations:

    • All-atom simulations of mnhF2 in a lipid bilayer environment

    • Coarse-grained modeling to observe large-scale conformational changes

  • Transport mechanism prediction:

    • Markov state modeling of the transport cycle

    • Free energy calculations for substrate binding and translocation

By combining these complementary approaches, researchers can develop a comprehensive understanding of mnhF2 antiporter function, substrate specificity, and potential role in antimicrobial resistance.

How does S. haemolyticus antibiotic resistance relate to membrane transport systems?

S. haemolyticus demonstrates extensive antibiotic resistance patterns that may involve membrane transport systems in several ways:

Direct transport-mediated resistance:

  • Efflux pumps like qacA, more prevalent in clinical S. haemolyticus isolates (65% vs. 39% in commensal isolates), can expel not only antiseptics but also fluoroquinolones and beta-lactams

  • Membrane transporters can maintain the proton-motive force under antibiotic stress, potentially contributing to phenotypic resistance

Genetic context of resistance determinants:

  • Resistance genes often co-localize with mobile genetic elements that may affect membrane transporter expression

  • The SPbeta-like phage identified in clinical isolates carries both aacA-aphA (gentamicin resistance) and dfrC (trimethoprim resistance) genes along with IS elements

  • IS256, associated with gentamicin resistance due to co-localization on transposon Tn4001, can affect global regulatory networks and potentially alter membrane transporter expression

Resistance-physiology connections:

  • Antiporter systems that regulate pH homeostasis may contribute to survival under antibiotic pressure

  • The distinct folB/folP variants in clinical isolates may interact with membrane transport systems to modulate cellular physiology

This complex interplay between genetic determinants of resistance and membrane transport systems like mnhF2 represents an important area for further research, particularly as S. haemolyticus ranks as the most antibiotic-resistant species among CoNS .

What genomic approaches can reveal the evolutionary significance of mnhF2 in S. haemolyticus?

To understand the evolutionary significance of mnhF2 in S. haemolyticus, researchers should employ these genomic approaches:

Comparative genomics:

  • Ortholog analysis:

    • Compare mnhF2 sequences across diverse S. haemolyticus isolates (n≥169) representing both clinical (n≥123) and commensal (n≥46) origins

    • Identify orthologs in related staphylococcal species and analyze evolutionary relationships

    • Calculate selection pressures (dN/dS ratios) to identify signatures of positive or purifying selection

  • Synteny analysis:

    • Examine the genomic context of mnhF2 across staphylococcal species

    • Determine if mnhF2 is located within the oriC environ, which contains nearly half of the coding sequences for virulence in S. haemolyticus

Population genomics:

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on core genome alignments including mnhF2

    • Map mnhF2 variants onto the species phylogeny to identify clade-specific polymorphisms

    • Apply Bayesian evolutionary analysis to estimate divergence times

  • Recombination detection:

    • Use methods like ClonalFrameML to identify recombination events affecting mnhF2

    • Determine if horizontal gene transfer has influenced mnhF2 evolution

Functional genomics integration:

  • Expression correlation analysis:

    • Perform transcriptomic analyses under various conditions to identify genes co-regulated with mnhF2

    • Use network analysis to position mnhF2 within functional pathways

  • Genetic association studies:

    • Correlate mnhF2 variants with phenotypic traits such as antibiotic resistance patterns

    • Perform genome-wide association studies (GWAS) to identify genetic variants linked to mnhF2 function

These approaches will help determine whether mnhF2 has played a role in the adaptation of S. haemolyticus to hospital environments and whether it contributes to the clear genomic segregation observed between clinical and commensal isolates .

What is the relationship between biofilm formation and membrane proteins like mnhF2 in S. haemolyticus?

The relationship between biofilm formation and membrane proteins like mnhF2 in S. haemolyticus involves several potential mechanisms:

Ion homeostasis in biofilm development:

  • Membrane antiporters like mnhF2 may regulate ion concentrations crucial for biofilm formation

  • pH regulation by antiporter systems could create microenvironments favorable for biofilm matrix components

  • Cation transport may influence extracellular polymeric substance production and stability

Regulatory connections:

  • IS256 elements, found predominantly in clinical isolates (86%), have been associated with both biofilm formation and antibiotic resistance

  • Membrane proteins may be part of stress response systems that trigger biofilm formation

  • Global regulatory networks affected by IS elements might coordinate both biofilm formation and membrane protein expression

Structural considerations:

  • Membrane proteins can serve as anchor points for biofilm matrix components

  • Cell surface properties influenced by membrane protein composition may affect initial attachment

  • Serine-rich repeat glycoproteins (SraP homologs) identified in clinical isolates may interact with membrane transport systems during biofilm development

Clinical implications:

  • Biofilm-forming S. haemolyticus isolates that are also resistant to oxacillin (mecA) and aminoglycosides (aacA-aphD) are most likely invasive isolates

  • The mucoid phenotype of S. haemolyticus has been associated with increased virulence and multi-drug resistance

Research exploring the functional relationship between biofilm formation and membrane transporters like mnhF2 could provide insights into novel therapeutic approaches targeting these systems.

What are the major challenges in expressing and purifying functional recombinant mnhF2?

Researchers face several significant challenges when expressing and purifying functional recombinant mnhF2:

Expression challenges:

ChallengeImpactSolutions
Membrane protein toxicityGrowth inhibition of expression hostUse tightly regulated expression systems; C41/C43(DE3) strains designed for toxic proteins
Protein misfoldingNon-functional protein; inclusion body formationLower expression temperature (16-20°C); co-express chaperones; use solubility enhancing tags
Low expression levelsInsufficient yield for downstream applicationsCodon optimization for expression host; use strong promoters with tunable induction
Lack of post-translational modificationsAltered protein functionConsider Gram-positive expression hosts more similar to S. haemolyticus

Purification challenges:

ChallengeImpactSolutions
Detergent selectionProtein denaturation or aggregationScreen multiple detergents (DDM, LMNG, DMNG); consider lipid nanodiscs or SMALPs
Stability during purificationLoss of function; degradationInclude stabilizing additives (glycerol, specific ions); maintain strict temperature control
Oligomeric state preservationLoss of native quaternary structureUse mild solubilization conditions; employ cross-linking approaches where appropriate
Function verificationDifficulty confirming transport activityDevelop robust functional assays; reconstitute in proteoliposomes for activity testing

Analytical challenges:

ChallengeImpactSolutions
Homogeneity assessmentDifficult to assess protein qualityCombine SEC-MALS with analytical ultracentrifugation; use native mass spectrometry
Lipid requirementsLoss of function without specific lipidsIdentify native lipid environment; supplement purification buffers with essential lipids
Structural characterizationDifficulty obtaining structural dataConsider lipid cubic phase crystallization; use single-particle cryo-EM approaches

By systematically addressing these challenges through method optimization and integration of complementary approaches, researchers can improve the likelihood of obtaining functional recombinant mnhF2 for detailed characterization.

How can researchers accurately determine the substrate specificity of mnhF2?

Determining the substrate specificity of mnhF2 requires a comprehensive, multi-faceted approach:

In vitro transport assays:

  • Reconstitution systems:

    • Incorporate purified mnhF2 into proteoliposomes with defined lipid composition

    • Establish ion gradients across the proteoliposome membrane

    • Measure transport of various substrates using radioisotope flux assays or fluorescent probes

  • Competition assays:

    • Perform transport assays with primary substrate in the presence of potential competing ions

    • Determine IC₅₀ values for various competing substrates

    • Calculate relative affinities based on competition profiles

  • Electrochemical measurements:

    • Use solid-supported membrane electrophysiology to measure charge translocation

    • Apply different ion gradients and measure resulting currents

    • Determine stoichiometry of transport by varying ion concentrations

Binding studies:

  • Isothermal titration calorimetry (ITC):

    • Directly measure thermodynamic parameters of substrate binding

    • Determine binding affinities (Kd), enthalpy (ΔH), and stoichiometry (n)

    • Compare binding parameters across potential substrates

  • Microscale thermophoresis (MST):

    • Measure changes in thermophoretic mobility upon substrate binding

    • Determine binding constants for various potential substrates

    • Requires minimal protein and is compatible with membrane proteins in detergent

Structural approaches:

  • Computational docking and molecular dynamics:

    • Generate homology models based on related transporters

    • Perform in silico docking of potential substrates

    • Use molecular dynamics simulations to assess binding stability and transport pathways

  • Site-directed mutagenesis:

    • Identify potential substrate-binding residues through sequence analysis

    • Create point mutations of these residues

    • Evaluate effects on transport activity and substrate specificity

  • Cryo-EM or X-ray crystallography:

    • Capture structures with bound substrates or substrate analogs

    • Identify binding sites and conformational changes associated with substrate binding

By combining these complementary approaches, researchers can develop a comprehensive understanding of mnhF2 substrate specificity, transport mechanism, and physiological role.

What strategies can address data inconsistencies in mnhF2 functional studies?

To address data inconsistencies in mnhF2 functional studies, researchers should implement the following strategies:

Standardization approaches:

  • Protocol standardization:

    • Establish detailed standard operating procedures (SOPs) for expression, purification, and functional assays

    • Create reference material banks of purified protein and standard substrate solutions

    • Implement quality control metrics for protein preparations (purity, homogeneity, activity)

  • Data normalization methods:

    • Develop internal standards for functional assays

    • Implement statistical approaches to normalize data across experiments

    • Use relative measurements when absolute values show high variability

Validation strategies:

  • Orthogonal method confirmation:

    • Verify key findings using multiple independent techniques

    • Compare results from different functional assays (e.g., fluorescence-based vs. radioisotope methods)

    • Use both in vitro and in vivo approaches where possible

  • Genetic validation:

    • Create knockout/complementation systems in S. haemolyticus

    • Perform site-directed mutagenesis to confirm functional residues

    • Use heterologous expression systems to isolate mnhF2 function

Troubleshooting framework:

  • Systematic variable analysis:

    • Create a matrix of experimental variables that might affect outcomes

    • Systematically test the impact of each variable

    • Develop robust assays that minimize sensitivity to variable parameters

  • Collaborative cross-validation:

    • Establish multi-laboratory validation of key findings

    • Share protocols and materials between research groups

    • Implement blind testing procedures for critical experiments

Data integration approaches:

  • Meta-analysis techniques:

    • Develop statistical methods to integrate data from multiple experiments

    • Weight data based on methodological quality and reproducibility

    • Identify patterns across datasets that may reveal underlying biological principles

  • Computational modeling:

    • Create predictive models that integrate diverse experimental datasets

    • Use machine learning approaches to identify patterns in inconsistent data

    • Develop in silico experiments to test hypotheses about sources of variability

By systematically implementing these strategies, researchers can address inconsistencies, improve reproducibility, and develop a more coherent understanding of mnhF2 function.

How might mnhF2 contribute to the hospital adaptation of S. haemolyticus?

The putative antiporter subunit mnhF2 may contribute to hospital adaptation of S. haemolyticus through several mechanisms:

Antimicrobial tolerance:

  • Ion homeostasis maintained by antiporter systems like mnhF2 may help S. haemolyticus survive exposure to antimicrobial agents

  • Regulation of intracellular pH could protect against antimicrobial compounds whose efficacy depends on pH gradients

  • The widespread use of antimicrobial agents has likely promoted the development of multi-drug resistant clones persisting in hospital environments

Stress response:

  • Hospital environments present multiple stresses (desiccation, osmotic changes, antimicrobial exposure)

  • Membrane antiporters may contribute to stress response mechanisms by maintaining ion gradients under challenging conditions

  • Clinical S. haemolyticus isolates show specific signatures associated with successful hospital adaptation

Genetic context:

  • The genomic location of mnhF2 may be significant if it is within regions affected by mobile genetic elements

  • IS256, found in 86% of clinical isolates but only 11% of commensal isolates, can shape the genome by affecting gene expression

  • Horizontal gene transfer, including acquisition of plasmids carrying resistance genes, has been shown to be a strong driver of evolution in successful epidemic staphylococcal strains

Biofilm contribution:

  • If mnhF2 contributes to biofilm formation, this would enhance persistence on medical devices and surfaces

  • Biofilm formation has been suggested as an important S. haemolyticus virulence determinant

  • Biofilm-forming S. haemolyticus isolates resistant to oxacillin and aminoglycosides are most likely invasive isolates

Future research should investigate whether variations in mnhF2 sequence or expression differ between clinical and commensal isolates, potentially contributing to the clear genomic segregation observed between these populations .

What novel therapeutic approaches might target bacterial antiporter systems like mnhF2?

Several innovative therapeutic approaches targeting bacterial antiporter systems like mnhF2 show promise:

Direct inhibition strategies:

  • Structure-based drug design:

    • Develop small molecule inhibitors targeting substrate binding sites or conformational changes

    • Design peptidomimetics that block transport channels or interfere with oligomerization

    • Create allosteric modulators that lock transporters in inactive conformations

  • Antibody-based approaches:

    • Develop single-domain antibodies (nanobodies) targeting extracellular loops

    • Create immunoconjugates combining antiporter targeting with antimicrobial payloads

    • Design bispecific antibodies targeting multiple membrane transport systems

Indirect targeting approaches:

  • Metabolic disruption:

    • Develop compounds that alter cellular ion pools, creating toxic imbalances when antiporters function

    • Target metabolic pathways that generate substrates for antiporter systems

    • Create protonophores specifically activated in the presence of antiporter activity

  • Regulatory disruption:

    • Identify and target transcriptional regulators of antiporter expression

    • Develop antisense oligonucleotides or CRISPR-based approaches to reduce antiporter expression

    • Design compounds that interfere with post-translational modifications required for antiporter function

Combination strategies:

  • Antibiotic potentiation:

    • Combine antiporter inhibitors with conventional antibiotics to overcome resistance

    • Develop dual-action molecules incorporating antiporter inhibition and antibiotic activity

    • Create targeted delivery systems that release antibiotics in response to antiporter activity

  • Anti-virulence approach:

    • Target antiporters involved in virulence factor expression or secretion

    • Develop compounds that interfere with biofilm formation mediated by antiporter systems

    • Design inhibitors that block stress response functions while preserving growth under normal conditions

These approaches represent promising avenues for addressing the significant challenge of antimicrobial resistance in S. haemolyticus, which ranks as the most antibiotic-resistant species among coagulase-negative staphylococci .

How can pan-genomic analysis inform our understanding of membrane transport systems in S. haemolyticus?

Pan-genomic analysis provides powerful insights into membrane transport systems in S. haemolyticus:

Comparative transport system analysis:

  • The pan-genome analysis of S. haemolyticus reveals a relatively stable core genome with a higher number of unique genes in commensal isolates

  • Pan-genomic approaches can identify the distribution of different transporter families across the species

  • Comparison of antiporter gene variations between the core and accessory genome can reveal evolutionary patterns

Evolutionary insights:

  • S. haemolyticus has an open pan-genome with steeper accumulation curves than S. epidermidis and S. aureus

  • Analysis of transporter genes across the pan-genome can reveal acquisition patterns through horizontal gene transfer

  • Identification of transporter gene variants under positive selection may highlight functionally important systems

Functional correlations:

  • Integration of pan-genomic data with phenotypic information can link specific transporter variants to functional outcomes

  • Correlation analysis between transporter genes and resistance markers may identify novel resistance mechanisms

  • Network analysis can position transporters like mnhF2 within the broader context of cellular processes

Clinical applications:

  • Identification of transporter genes exclusively associated with clinical isolates may provide novel diagnostic markers

  • Pan-genomic patterns may reveal hospital-adapted clone-specific variants with potential as therapeutic targets

  • Prediction of functional consequences based on genomic variations can inform personalized treatment approaches

Methodological approach:

  • Sequence diverse isolates representing both clinical (n≥123) and commensal (n≥46) origins

  • Identify all membrane transporter genes using specialized tools like TransportDB

  • Classify transporters by family, substrate specificity, and genomic context

  • Perform comparative analysis between clinical and commensal isolates

  • Correlate transporter gene presence/absence and sequence variations with phenotypic data

  • Validate key findings with functional studies of specific transporters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.