Recombinant Staphylococcus haemolyticus Putative antiporter subunit mnhG2 (mnhG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mnhG2; mrpG2; SH2269; Putative antiporter subunit mnhG2; Mrp complex subunit G2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
mnhG2
Target Protein Sequence
MAQINEIIELIAALLIFLGSIIAVISAIGIVKFQDVFLRSHASTKSSTLSVLLTLVGVLI YFTNEQSFFSVRLLLSIVFINLTSPVGMHLVARAAYRTGAYMYRKDDAPSRSSILLSSKE YNSTEELKNRARIREERREKIYYDVQKQRQKEKQQEENIESLSEARRETKD
Uniprot No.

Target Background

Database Links

KEGG: sha:SH2269

STRING: 279808.SH2269

Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the genetic structure of mnhG2 differ between clinical and commensal S. haemolyticus isolates?

Based on comparative genomic analyses, S. haemolyticus shows clear genetic segregation between clinical and commensal isolates. Clinical isolates demonstrate specific genetic signatures distinguishing them from commensal strains . While specific data for mnhG2 is not directly presented in current research, the patterns observed in other membrane-associated proteins suggest potential variations.

Phylogenetic reconstruction has grouped S. haemolyticus isolates into six distinct clades with differential distribution of clinical and commensal isolates . Given that surface and membrane-associated genes often show enhanced variation in hospital-adapted strains, mnhG2 may exhibit similar patterns of adaptation in clinical versus commensal isolates.

What experimental approaches are recommended for expression and purification of recombinant MnhG2 protein?

For successful expression and purification of recombinant MnhG2:

  • Vector selection: Choose expression vectors optimized for membrane proteins, preferably with fusion tags that enhance solubility (e.g., MBP, SUMO).

  • Expression system: E. coli strains specifically engineered for membrane protein expression (C41/C43) are recommended to avoid toxicity issues often encountered with antiporter proteins.

  • Induction conditions: Low temperature induction (16-18°C) with reduced IPTG concentration (0.1-0.5 mM) typically yields better folding of membrane proteins.

  • Solubilization: Carefully select detergents for membrane protein extraction; mild detergents like DDM, LMNG, or digitonin often preserve functional integrity.

  • Purification strategy: Implement a two-step purification approach using affinity chromatography followed by size exclusion chromatography.

For functional analysis, researchers should consider liposome reconstitution assays to evaluate ion transport capacity, as direct measurement of antiporter activity requires a membrane environment.

What are the optimal conditions for functional characterization of recombinant MnhG2 in vitro?

Functional characterization of recombinant MnhG2 requires careful experimental design:

  • Proteoliposome reconstitution: Incorporate purified MnhG2 into liposomes with appropriate lipid composition mimicking bacterial membranes (typically phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin).

  • Ion transport assays:

    • pH-sensitive fluorescent dyes (BCECF) can monitor H+ transport

    • Na+-sensitive dyes (SBFI) for sodium transport

    • Radioactive isotopes (22Na+) for direct quantitative measurement

  • Electrochemical gradient establishment: Generate artificial pH and/or Na+ gradients across the proteoliposome membrane to drive antiporter activity.

  • Inhibitor profiling: Test known antiporter inhibitors (amiloride derivatives, harmaline) to confirm specificity.

  • Site-directed mutagenesis: Mutate conserved residues to identify critical functional domains.

When interpreting results, it's important to consider that MnhG2 may function as part of a larger complex rather than in isolation, which could affect activity measurements. The high genomic plasticity observed in S. haemolyticus clinical isolates, with significant variation in surface-associated genes, suggests potential functional adaptations in membrane proteins like MnhG2 .

How can researchers distinguish between the functions of MnhG2 and other antiporter subunits in S. haemolyticus?

Distinguishing the specific role of MnhG2 from other antiporter subunits requires a multi-faceted approach:

  • Gene knockout/complementation studies: Create ΔmnhG2 deletion mutants and compare phenotypic changes with wild-type strains. Complementation with the wild-type gene should restore function if the effects are specific to MnhG2.

  • Co-immunoprecipitation: Identify protein-protein interactions between MnhG2 and other antiporter subunits to map the complex architecture.

  • Subunit-specific antibodies: Generate antibodies against unique epitopes of MnhG2 for localization and quantification studies.

  • Heterologous expression: Express individual subunits or subcomplexes in appropriate model systems to assess partial functions.

  • Structural biology approaches: Cryo-EM or X-ray crystallography of individual subunits versus complete complexes can reveal structural contributions.

When conducting these studies, researchers should consider that S. haemolyticus has an open pan-genome with considerable genetic variability . This genomic plasticity means that antiporter complexes may vary between strains, particularly between clinical and commensal isolates, requiring careful strain selection for comparative studies.

What methodologies are most effective for analyzing mnhG2 expression patterns across different growth conditions?

To effectively analyze mnhG2 expression patterns:

  • Quantitative RT-PCR: Design primers specific to mnhG2 to quantify mRNA levels under various conditions, including:

    • Different pH values (5.5-8.0)

    • Varying NaCl concentrations (0-2M)

    • Antibiotic exposure at sub-inhibitory concentrations

    • Biofilm versus planktonic growth

  • RNA-Seq: For genome-wide expression analysis, comparing mnhG2 expression with other genes under stress conditions.

  • Reporter gene fusions: Construct mnhG2 promoter-reporter fusions (e.g., lacZ, GFP) to monitor expression in real-time.

  • Proteomics: Implement targeted proteomics (MRM-MS) to quantify MnhG2 protein levels directly.

  • Single-cell analysis: Fluorescence microscopy with reporter strains can reveal heterogeneity in expression at the cellular level.

When comparing clinical and commensal isolates, researchers should note that clinical S. haemolyticus isolates show specific genetic signatures that may affect gene expression patterns . These isolates demonstrate higher prevalence of mobile genetic elements like IS256 (86% in clinical vs. 11% in commensal isolates) and Tn552/IS481 (72% in clinical vs. 13% in commensal isolates) , which can influence expression of neighboring genes through insertional effects or regulatory changes.

Is there evidence that MnhG2 contributes to antimicrobial resistance in clinical S. haemolyticus isolates?

While direct evidence specifically linking MnhG2 to antimicrobial resistance in S. haemolyticus is limited, several indirect associations can be drawn based on current research:

  • Na+/H+ antiporter function: Bacterial antiporters contribute to pH homeostasis and ion balance, which can indirectly affect antibiotic susceptibility by altering membrane potential and proton motive force.

  • MDR prevalence in clinical isolates: 88% of clinical S. haemolyticus isolates demonstrate multi-drug resistance compared to only 11% of commensal isolates . This suggests that membrane adaptations, potentially including antiporter complexes, may contribute to the resistance phenotype.

  • Association with resistance determinants: Genes encoding membrane proteins like MnhG2 may be co-selected with resistance determinants. In clinical S. haemolyticus isolates, there is enrichment of IS256 and Tn552/IS481 elements , which often carry resistance genes.

  • Potential efflux pump connections: Some antiporter complexes can function as part of broader efflux systems that contribute to antibiotic resistance, particularly for charged antimicrobials.

Researchers investigating MnhG2's potential role in antimicrobial resistance should design experiments comparing isogenic mutants (ΔmnhG2) with wild-type strains for antibiotic susceptibility testing across different classes of antimicrobials, particularly those affected by membrane potential.

How does MnhG2 expression compare between biofilm-forming and non-biofilm-forming S. haemolyticus strains?

The relationship between MnhG2 expression and biofilm formation represents an important research question:

Biofilm formation is a key virulence determinant in S. haemolyticus, particularly in clinical isolates . Comparative analysis has shown that biofilm-forming S. haemolyticus isolates that are resistant to oxacillin (mecA) and aminoglycosides (aacA-aphD) are most likely invasive isolates, whereas absence of these traits strongly indicates a commensal isolate .

To investigate MnhG2's role in biofilm formation:

  • Expression profiling: Compare mnhG2 expression levels between:

    • Strong biofilm formers vs. weak/non-biofilm formers

    • Planktonic cells vs. biofilm-embedded cells

    • Different stages of biofilm development

  • Mutant phenotype analysis: Evaluate how ΔmnhG2 deletion affects:

    • Initial attachment to surfaces

    • Biofilm maturation

    • Extracellular matrix composition

    • Biofilm dispersal

    • Antibiotic tolerance within biofilms

  • Microscopy analysis: Use fluorescent protein fusions to localize MnhG2 within biofilm structures and determine if its distribution changes in different biofilm regions or developmental stages.

The connection between ion homeostasis (potentially regulated by antiporter complexes like MnhG2) and biofilm formation is particularly relevant as environmental pH and ion concentrations significantly affect biofilm development in staphylococci.

What is the evolutionary significance of MnhG2 variants in hospital-adapted S. haemolyticus lineages?

The evolutionary trajectory of MnhG2 in hospital-adapted lineages reflects broader adaptation patterns observed in S. haemolyticus:

  • Selective pressure: Hospital environments exert unique selective pressures through antibiotic exposure, disinfectants, and altered nutrient availability. These pressures likely drive evolution of membrane proteins like MnhG2 that mediate environmental interactions.

  • Clonal distribution: Phylogenetic analysis has revealed distinct clustering of clinical S. haemolyticus isolates, suggesting clonal expansion of successful hospital-adapted lineages . MnhG2 variants may be specific to these lineages.

  • Mobile genetic elements: Hospital-adapted S. haemolyticus shows enrichment of mobile genetic elements, particularly IS256 (86% in clinical vs. 11% in commensal isolates) . These elements can drive protein evolution through insertional mutagenesis or regulatory changes affecting expression.

  • Genome plasticity: S. haemolyticus demonstrates an open pan-genome with considerable genetic variability . The pan-genome accumulation curve for S. haemolyticus is steeper than those observed for S. aureus and S. epidermidis, indicating higher genomic plasticity .

Researchers investigating MnhG2 evolution should consider performing selection pressure analysis (dN/dS ratios) across clinical and commensal isolates to identify potential adaptive mutations. Additionally, comparing mnhG2 sequences from historical isolates with contemporary strains could reveal evolutionary trajectories under hospital selection.

How do post-translational modifications affect MnhG2 function in S. haemolyticus?

Post-translational modifications (PTMs) of MnhG2 represent an advanced area of investigation:

  • Phosphorylation: Bacterial antiporter proteins are often regulated by phosphorylation, potentially modulating:

    • Transport kinetics

    • Substrate specificity

    • Protein-protein interactions within the complex

    • Response to environmental stimuli

  • Methodological approaches:

    • Phosphoproteomic analysis using LC-MS/MS to identify modification sites

    • Site-directed mutagenesis of identified PTM sites to evaluate functional consequences

    • Kinase inhibitor studies to identify regulatory pathways

    • In vitro phosphorylation/dephosphorylation assays to evaluate direct effects on transport

  • Strain comparisons: Compare PTM patterns between:

    • Clinical vs. commensal isolates

    • Antibiotic-resistant vs. susceptible strains

    • Biofilm vs. planktonic growth conditions

The presence of distinct genetic signatures in clinical S. haemolyticus isolates suggests potential differences in regulatory mechanisms, including those affecting PTMs. These differences may contribute to the enhanced ability of clinical isolates to persist in hospital environments and develop antibiotic resistance.

What structural features distinguish MnhG2 from homologous antiporter subunits in other staphylococcal species?

Comparative structural analysis of MnhG2 across staphylococcal species reveals important evolutionary adaptations:

  • Structural prediction and analysis:

    • Homology modeling based on known antiporter structures

    • Identification of transmembrane domains and functional motifs

    • Comparison of predicted structures across staphylococcal species

  • Key structural differences:

    • S. haemolyticus demonstrates significant genomic plasticity compared to other staphylococci

    • The oriC environ in S. haemolyticus is significantly larger than in S. aureus and S. epidermidis, and contains almost half of the candidate coding sequences for virulence

    • Clinical isolates show distinct genetic signatures that may extend to membrane proteins

  • Functional implications:

    • Alterations in ion selectivity filter residues

    • Differences in regulatory domains

    • Species-specific protein-protein interaction interfaces

  • Experimental approaches:

    • Site-directed mutagenesis of divergent residues

    • Chimeric protein construction to identify functional domains

    • Heterologous expression to compare function across species

Structural studies should consider that the accessory genome of clinical S. haemolyticus isolates is characterized by high prevalence of antibiotic resistance genes and mobile genetic elements , which may drive structural adaptations in membrane proteins like MnhG2 through co-selection or compensatory mutations.

How can systems biology approaches integrate MnhG2 function into broader metabolic networks of S. haemolyticus?

Systems biology offers powerful frameworks to understand MnhG2 within the broader context of S. haemolyticus physiology:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate MnhG2 expression with global metabolic shifts

    • Identify condition-specific regulatory networks

  • Network analysis:

    • Construct protein-protein interaction networks centered on MnhG2

    • Identify metabolic pathways affected by MnhG2 activity

    • Predict synthetic lethal interactions

  • Metabolic flux analysis:

    • Measure changes in central carbon metabolism when mnhG2 is deleted

    • Quantify effects on proton motive force and energy generation

    • Assess impact on nutrient transport systems

  • Mathematical modeling:

    • Develop kinetic models of ion transport

    • Integrate into genome-scale metabolic models

    • Simulate effects of environmental perturbations

When analyzing these networks, researchers should consider that clinical S. haemolyticus isolates exhibit significant differences in genetic content compared to commensal isolates . The comparative genomic analysis of 123 clinical and 46 commensal isolates revealed distinct distribution patterns across six phylogenetic clades , suggesting that metabolic networks may differ substantially between hospital-adapted and commensal lineages.

What is the potential of MnhG2 as a drug target for novel anti-staphylococcal therapies?

The evaluation of MnhG2 as a potential therapeutic target should consider:

  • Target validation criteria:

    • Essentiality assessment through conditional mutants

    • Conservation across clinical isolates

    • Absence of functional homologs in human cells

    • Accessibility to inhibitors (as a membrane protein)

  • Inhibitor discovery strategies:

    • High-throughput screening of chemical libraries

    • Structure-based drug design if structural data becomes available

    • Repurposing of known ion transport inhibitors

    • Peptide-based inhibitors targeting protein-protein interactions

  • Therapeutic considerations:

    • Multi-drug resistance is present in 88% of clinical S. haemolyticus isolates

    • Novel targets beyond conventional antibiotic classes are urgently needed

    • The distinction between clinical and commensal isolates suggests potential for selective targeting

  • Combination approaches:

    • Synergistic potential with existing antibiotics

    • Biofilm disruption capabilities

    • Resistance suppression strategies

Researchers should note that successful hospital-adapted S. haemolyticus clones show specific genetic signatures , suggesting that targeting hospital-specific adaptations might offer selective approaches against pathogenic strains while sparing commensal microbiota.

How does horizontal gene transfer affect the distribution and evolution of mnhG2 variants in clinical settings?

Horizontal gene transfer (HGT) significantly shapes S. haemolyticus evolution in clinical settings:

  • Evidence from genomic analysis:

    • Mobile genetic elements are enriched in clinical isolates

    • IS256 is present in 86% of clinical isolates vs. 11% of commensal isolates

    • Tn552/IS481 is found in 72% of clinical isolates vs. 13% of commensal isolates

    • Phage vB_Saus_phi2/StauST398-2 was identified exclusively in clinical isolates (51%)

  • Impact on mnhG2:

    • Potential for gene acquisition or modification through recombination

    • Regulatory changes through mobile element insertion

    • Co-transfer with antibiotic resistance determinants

  • Experimental approaches:

    • Population genomics to track mnhG2 variants

    • Molecular dating of gene acquisition events

    • In vitro transfer studies

    • Comparative analysis across healthcare facilities

  • Implications for surveillance:

    • Tracking emerging variants with enhanced function

    • Identifying high-risk clones for infection control

    • Predicting evolutionary trajectories

Research indicates that HGT is a driving force in S. haemolyticus evolution, particularly in response to the selective pressure of broad-spectrum antibiotics used in hospitals . This suggests mnhG2 variants may be subjected to similar evolutionary pressures, potentially leading to functional adaptations that enhance survival in healthcare settings.

What novel methodologies are being developed to study the structure-function relationship of antiporter subunits like MnhG2?

Cutting-edge methodologies for studying membrane proteins like MnhG2 include:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for near-atomic resolution structures

    • Solid-state NMR spectroscopy for dynamics studies

    • Mass photometry for complex assembly analysis

    • HDX-MS for conformational changes during transport cycles

  • Single-molecule approaches:

    • FRET-based sensors to monitor conformational changes

    • Electrical recordings in artificial bilayers

    • Nanodiscs for stabilization in near-native environments

    • Atomic force microscopy for mechanical properties

  • Computational methods:

    • Molecular dynamics simulations of ion translocation

    • Machine learning for structure prediction

    • Quantum mechanics/molecular mechanics for reaction mechanisms

    • Network analysis of evolutionary coupling data

  • Genome editing innovations:

    • CRISPR interference for tunable expression control

    • Base editing for precise point mutations

    • In situ tagging for native-level studies

These methodologies should be applied with consideration of S. haemolyticus's genomic plasticity. The pan-genome analysis reflects a relatively stable core genome comparable to other staphylococci, but with a higher number of unique genes in commensal isolates and a steeper pan-genome accumulation curve than observed for S. epidermidis and S. aureus , indicating greater genetic diversity that may extend to membrane proteins like MnhG2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.