Recombinant Staphylococcus haemolyticus Sensor protein kinase walK (walK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
walK; vicK; SH0018; Sensor protein kinase WalK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
walK
Target Protein Sequence
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNSLEKELTNNFMKNIKQYATQLEVNI ERIYRDDPSNAQKEVQSLLNEYANRQEIEEIRFIDKDQIIMATAKISSHNMINQKVNDNS VQKALSLGESNSHNVLKDYGSGKERIWIYNLPVKNGNETIGNIYIESNINDVYNQLNNIN QIFIIGTAISLFITVILGFFIARTITRPITDMRNQTVEMSKGNYTQRVKIYGNDEIGELA LAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRVRIVNDMAIKMLGMSKE DLIGYYMLSVLNLEDEFSLDEIQENNDSFLLDINEDEGIIARVNFSTIVQETGFVTGYIA VLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGVWKDDNLAPSFLSVTRE ETERMIRLVNDLLQLSKMDNESEQITKEIVDFNMFINKIINRHEMAAKDTTFVREIPSET IFTEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQNALYNRMTIRIKDNGIGIPINKV DKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVI DDGDWDEE
Uniprot No.

Target Background

Function
WalK is a sensor protein kinase belonging to the two-component regulatory system WalK/WalR in *Staphylococcus haemolyticus*. It functions as a sensor, undergoing autophosphorylation at a histidine residue before transferring the phosphate group to WalR.
Database Links

KEGG: sha:SH0018

STRING: 279808.SH0018

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the WalK/WalR two-component system and why is it significant for research?

The WalK/WalR system represents an essential two-component regulatory system (TCS) found in Gram-positive bacteria, including Staphylococcus species. This system consists of the histidine kinase WalK (sensor protein) and its cognate response regulator WalR. The system is particularly significant because it is essential for bacterial growth and viability in many staphylococcal species, making it a potential antimicrobial target .

The WalK/WalR system functions through a phosphorelay mechanism where WalK autophosphorylates at a conserved histidine residue in response to environmental signals and subsequently transfers the phosphoryl group to an aspartate residue on WalR. Phosphorylated WalR then modulates the expression of genes involved in cell wall metabolism, autolysis, and other essential cellular processes .

How does WalK structure relate to its function across different Staphylococcus species?

WalK contains several conserved domains that are critical for its function across Staphylococcus species. The protein typically includes:

  • An N-terminal sensor domain with transmembrane regions

  • A HAMP domain for signal transduction

  • A dimerization and histidine phosphorylation (DHp) domain containing the conserved histidine residue

  • A C-terminal catalytic ATP-binding (CA) domain with HATPase_c fold

  • A C-terminal tail (CTT) that plays a crucial role in interaction with WalR

While the intracellular domains show high conservation across species, the transmembrane and extracellular domains vary significantly, likely reflecting species-specific sensing mechanisms. Unlike streptococcal WalK, staphylococcal WalK is essential for bacterial viability, indicating potential differences in physiological roles across genera despite structural similarities .

Is WalK essential in all staphylococcal species, and how can researchers experimentally verify this?

WalK has been definitively established as essential in Staphylococcus aureus, but its essentiality across all staphylococcal species requires verification on a case-by-case basis. For S. haemolyticus and other staphylococcal species, researchers can employ several approaches to determine essentiality:

Experimental methods to verify WalK essentiality:

  • Regulated expression systems (e.g., Pspac-promoter regulated walK mutants with LacI-expression vectors) to demonstrate growth dependence on WalK expression

  • Temperature-sensitive mutagenesis approaches

  • CRISPR interference (CRISPRi) for conditional knockdown

  • Transposon mutagenesis followed by deep sequencing (Tn-seq) to identify essential genes

In S. aureus RN4220, researchers confirmed WalK essentiality by creating a Pspac-promoter regulated walK mutant (RNPspac-WalK) with a LacI-expression vector (pFF40), demonstrating that bacterial growth was dependent on WalK expression .

What is the significance of the W-acidic motif in WalK's C-terminal tail, and how does it impact WalK-WalR interaction?

The W-acidic motif in WalK's C-terminal tail (CTT) represents a critical functional element characterized by a conserved tryptophan residue surrounded by acidic amino acids. Research in S. mutans has revealed that this motif is essential for:

  • Stable interaction between WalK and WalR

  • Efficient phosphotransferase activity

  • Effective phosphatase activity

  • Competition with DNA containing WalR binding motifs for WalR interaction

Mutation studies have shown that altering the tryptophan residue (W443 in S. mutans) to alanine completely disrupts the WalK-WalR interaction, as measured by both GST pull-down assays and Isothermal Titration Calorimetry (ITC). While the tryptophan mutation does not affect WalK's autokinase activity, it significantly impairs both phosphotransferase and phosphatase functions .

Notably, this W-acidic motif is conserved in S. aureus WalK as well, though its CTT is relatively shorter. The presence of this conserved feature across different bacterial genera highlights its fundamental importance in WalRK signaling mechanisms .

How do the phosphotransferase and phosphatase activities of WalK regulate WalR, and what experimental approaches can measure these activities?

WalK regulates WalR through its dual enzymatic activities: phosphotransferase (activating) and phosphatase (deactivating). These opposing functions allow for precise control of WalR-mediated gene expression in response to environmental stimuli.

Phosphotransferase activity measurement:

  • ATPγS-based protocol: Incubate WalK proteins with ATPγS in kinase reaction buffer, followed by addition of WalR. The phosphoryl transfer from WalK to WalR results in decreased phosphorylation of WalK, which can be monitored over time .

  • Direct quantification challenges: Due to the intrinsic phosphatase activity of WalK, direct quantification of phosphorylated WalR can be difficult. Therefore, the phosphotransferase activity is often analyzed by measuring the reduction of phosphorylated WalK .

Phosphatase activity measurement:

  • Phos-tag SDS-PAGE separation: Pre-phosphorylate WalR with acetyl phosphate (AcP), then incubate with WalK. Separate the phosphorylated and dephosphorylated forms of WalR using Phos-tag SDS-PAGE and quantify the ratio over time .

Studies with WalK CTT mutants have demonstrated that the W-acidic motif is critical for both activities. The W443A mutant and CTT deletion mutants significantly lose both phosphotransferase and phosphatase activities, while maintaining normal autokinase function .

What are the differences in WalK function between various staphylococcal species and other Gram-positive bacteria?

WalK function varies significantly across bacterial species, with notable differences between staphylococcal and streptococcal homologs:

CharacteristicStaphylococcal WalKStreptococcal WalK
EssentialityEssential for viabilityNot essential
Transmembrane domainsSpecies-specific arrangementsDifferent from staphylococcal homologs
Extracellular domainsContains Cache domainsDiffers in structure
Intracellular domainsHighly conservedConserved
C-terminal tailPresent with W-acidic motifLonger CTT with W-acidic motif
Autolysis regulationMinimal impact in S. aureusSpecies-dependent

Within staphylococcal species, WalK's role in cell wall metabolism appears generally conserved, but species-specific differences exist:

  • In S. aureus, WalK has limited impact on autolysis regulation, while WalR plays a significant role in controlling both Triton X-100-induced and penicillin-induced autolysis .

  • Species-specific differences in WalK regulatory targets likely exist among staphylococci, potentially reflecting their distinct ecological niches and pathogenic mechanisms.

  • The extracellular sensing domains show greater variation than the highly conserved intracellular catalytic components, suggesting adaptation to species-specific environmental cues .

What are the recommended approaches for expressing and purifying recombinant WalK for in vitro studies?

For successful expression and purification of recombinant WalK from staphylococcal species, researchers should consider the following protocol:

Expression system selection:

  • E. coli BL21(DE3) is typically used for recombinant expression of staphylococcal WalK

  • Consider using pET-based vectors with N-terminal His-tags for efficient purification

  • For membrane-associated full-length WalK, expression in E. coli C43(DE3) strain may improve yields

Recommended purification protocol:

  • Express the intracellular portion of WalK (e.g., residues 196-450 containing DHp, CA domains, and CTT) for optimal solubility

  • Lyse cells in buffer containing 20 mM Tris-HCl (pH 8.0), 200 mM NaCl, and protease inhibitors

  • Clarify lysate by centrifugation (16,000 × g, 30 min, 4°C)

  • Purify using Ni-NTA affinity chromatography

  • Further purify by size exclusion chromatography

  • Verify protein integrity by SDS-PAGE and Western blotting with anti-His or specific anti-WalK antibodies

  • For functional studies, confirm activity using autokinase assays with ATPγS

For structure-function studies, additional considerations include:

  • Expression of specific domains (DHp, CA, CTT) to study their individual contributions

  • Use of point mutations (e.g., W443A) to investigate the role of specific residues

  • Buffer optimization for stability (20% v/v glycerol often improves stability)

How can researchers effectively study the WalK-WalR interaction in vitro?

Several complementary techniques can be employed to study the WalK-WalR interaction with high sensitivity and specificity:

1. GST pull-down assays:

  • Express WalK as a GST-fusion protein and WalR with a different tag (e.g., His-tag)

  • Immobilize GST-WalK on glutathione-Sepharose beads

  • Incubate with purified WalR protein

  • Wash extensively and elute complexes

  • Analyze by SDS-PAGE and Western blotting

  • This method can identify domains involved in interaction by testing truncated constructs

2. Isothermal Titration Calorimetry (ITC):

  • Provides quantitative binding parameters (Kd, ΔH, ΔS, stoichiometry)

  • Recommended conditions:

    • Temperature: 25°C

    • Cell: 200 μl of 20 μM WalR protein solution

    • Syringe: 41 μl of 500 μM WalK

    • Buffer: 20 mM Tris-HCl (pH 8.0), 200 mM NaCl, 20% v/v glycerol

    • Titration parameters: 60s delay time for first 1-μl injection, 20 intervals of 2-μl injections with 120-150s spacing

    • Stirring speed: 1,000 rpm

    • Reference power: 5 μcal/s

3. Surface Plasmon Resonance (SPR):

  • Allows real-time monitoring of association and dissociation kinetics

  • Immobilize WalR on sensor chip and flow WalK as analyte, or vice versa

  • Can determine kon and koff rates in addition to equilibrium binding constants

These techniques have revealed important insights, such as the critical role of the W-acidic motif in the WalK CTT for WalR interaction, with binding affinities in the low micromolar range (Kd = 1.21 μM for wild-type WalK-WalR interaction) .

What genetic approaches can be used to study WalK function in vivo?

Several genetic approaches can be employed to study WalK function in vivo, with considerations for its essential nature in staphylococcal species:

1. Conditional expression systems:

  • Pspac-promoter regulated walK with LacI repressor control

  • ATc-inducible or tetracycline-repressible systems

  • These approaches allow regulated depletion of WalK to study phenotypic consequences

2. Site-directed mutagenesis:

  • For S. mutans, the marker-free Cre-loxP method has been successfully employed:

    • Create a plasmid containing an intergenic region between walK and adjacent genes

    • Engineer with a SmaI restriction site for loxP insertion and desired mutations

    • Insert a loxP-kanamycin resistance cassette

    • Linearize and transform into bacteria

    • Express Cre recombinase to excise the integrated loxP-Kan cassette

    • Remove Cre plasmid by temperature shift

    • Verify mutations by PCR and DNA sequencing

3. Domain swap experiments:

  • Replace domains between WalK proteins from different species

  • Particularly useful for studying the role of species-specific extracellular sensing domains

  • Can help identify determinants of substrate specificity

4. Reporter systems:

  • Construct transcriptional fusions between WalR-regulated promoters and reporter genes (e.g., gfp, lacZ)

  • Monitor changes in expression upon WalK mutation or depletion

  • Useful for identifying and characterizing WalK-WalR regulatory targets

When working with essential genes like walK in staphylococcal species, careful experimental design is critical to ensure viability while studying gene function.

How should researchers interpret discrepancies between in vitro and in vivo WalK activity data?

Discrepancies between in vitro and in vivo WalK activity data are common and can result from several factors:

Common causes of discrepancies:

  • Membrane context: Full-length WalK is a membrane protein whose activity is influenced by its lipid environment. In vitro studies often use truncated versions lacking membrane domains, potentially altering native activity profiles.

  • Missing cofactors or interaction partners: In vivo, WalK may interact with additional proteins or be influenced by small molecule ligands absent in purified systems.

  • Concentration effects: Protein concentrations used in vitro (typically μM range) may not reflect physiological concentrations in bacterial cells.

  • Post-translational modifications: In vivo modifications may alter WalK activity but be absent in recombinant systems.

Recommended analytical approaches:

  • Complementary methods: Combine in vitro biochemical assays with in vivo genetic studies and phenotypic analyses.

  • Domain-specific analyses: For WalK, study the intracellular portion (DHp, CA domains, and CTT) separately from the membrane and extracellular domains to isolate specific functions. Research has shown that while the W443A mutation in the CTT disrupts WalK-WalR interaction and phosphotransferase activity in vitro, it does not affect autokinase activity .

  • Physiological relevance assessment: When studying autolysis regulation, use both detergent-induced (Triton X-100) and antibiotic-induced (penicillin) lysis assays to comprehensively assess WalK's role, as studies in S. aureus have shown differential responses to these lytic agents .

  • Environmental context consideration: Include physiologically relevant ions, pH, and temperature in in vitro experiments to better mimic in vivo conditions.

What are the key considerations for analyzing WalK phosphorylation states and enzymatic activities?

Analyzing WalK phosphorylation states and enzymatic activities requires careful attention to several technical considerations:

Phosphorylation state analysis:

  • ATPγS-based protocols: Use ATPγS (a non-hydrolyzable ATP analog) for stable thiophosphorylation:

    • Incubate WalK (5 μM) with ATPγS (100 μM) in kinase reaction buffer

    • Standard buffer: 20 mM Tris-HCl (pH 7.4), 100 mM NaCl, 50 mM KCl, 2 mM MgCl₂

    • Detect thiophosphorylated proteins using anti-thiophosphate antibodies

  • Anti-phosphohistidine antibodies: For ATP-based phosphorylation, use anti-N1-phosphohistidine (1-pHis) antibodies (e.g., MABS1352, Sigma-Aldrich, 1:1,000 dilution)

  • Phos-tag SDS-PAGE: For separation of phosphorylated and non-phosphorylated forms of WalR

Enzymatic activity analysis challenges:

  • Autokinase activity: Generally robust and less affected by mutations outside the catalytic core. The W443A mutation in the CTT does not affect autokinase activity despite disrupting WalK-WalR interaction .

  • Phosphotransferase activity: Challenging to measure directly due to concurrent phosphatase activity. Best analyzed by monitoring reduction of phosphorylated WalK upon WalR addition .

  • Phosphatase activity: Extremely rapid (can complete in <1 min). Requires careful time-course analyses with pre-phosphorylated WalR (using acetyl phosphate) .

Data normalization and quantification:

  • Use ImageJ (Fiji package) for densitometric analysis of Western blots

  • Normalize phosphorylation levels to total protein amount

  • For phosphotransferase/phosphatase assays, normalize to initial phosphorylation levels (0 min timepoint)

  • Perform at least three independent experiments for statistical validation

  • Apply appropriate statistical tests (e.g., Student's t-tests) to compare mutants to wild-type

How do mutations in the W-acidic motif of WalK's C-terminal tail affect different functional activities?

Mutations in the W-acidic motif of WalK's C-terminal tail have differential effects on various functional activities, providing insight into structure-function relationships:

MutationAutokinase ActivityPhosphotransferase ActivityPhosphatase ActivityWalR InteractionIn vivo Effects
Wild-type100%100%100%Strong (Kd = 1.21 μM)Normal transcriptional regulation and biofilm formation
D441A (acidic residue)UnaffectedUnaffectedDecreasedMaintainedNot fully characterized
W443A (tryptophan)UnaffectedSignificantly impairedSignificantly disruptedUndetectable by ITCImpaired transcriptional regulation and biofilm formation
Δtail (CTT deletion)UnaffectedSignificantly impairedSignificantly disruptedUndetectable by ITCImpaired function similar to W443A

These data demonstrate that:

  • The conserved tryptophan residue (W443 in S. mutans) is critical for WalK-WalR interaction and subsequent signaling functions, but not for WalK's intrinsic autokinase activity .

  • The W-acidic motif likely serves as a specific interaction surface for WalR binding, facilitating both phosphotransfer and phosphatase activities .

  • The WalK CTT appears to interact with both the receiver domain (RD) and DNA-binding domain (DBD) of WalR, as demonstrated by domain-specific pull-down experiments. Intriguingly, the DBD interaction with WalK was more readily detected than the RD interaction, suggesting complex interaction dynamics .

  • The differential effects of mutations highlight the modular nature of WalK's functions, with distinct structural elements mediating specific activities in the signal transduction process .

These findings have important implications for understanding WalK function across staphylococcal species and may guide rational approaches to targeting this essential protein for antimicrobial development.

How does WalK's differential regulation of autolysis compare across staphylococcal species?

Research in S. aureus has revealed an intriguing pattern where WalK and WalR differentially regulate bacterial autolysis, raising important questions about species-specific functions:

In S. aureus RN4220, down-regulation of walR expression effectively inhibited Triton X-100-induced lysis and had a weak impact on penicillin-induced cell lysis. In contrast, down-regulation of walK expression had no significant influence on either Triton X-100 or penicillin-caused autolysis .

This differential regulation suggests:

  • WalR and WalK might control autolysis through partially independent pathways

  • WalR's activity may be regulated by phosphorylation from sources other than WalK

  • Species-specific adaptations may exist in the WalRK regulatory network

For researchers investigating this phenomenon in S. haemolyticus and other staphylococcal species, several approaches should be considered:

  • Comparative autolysis assays: Perform standardized Triton X-100 and penicillin-induced autolysis assays across multiple staphylococcal species with conditional walK and walR expression

  • Transcriptomic profiling: Compare gene expression patterns in WalK- and WalR-depleted cells, particularly focusing on autolysis-related genes like cidA, which shows decreased transcription in walR down-regulated S. aureus

  • Zymogram analysis: Examine cell wall hydrolytic activities in cell lysates from different staphylococcal species with modulated WalK/WalR expression to identify species-specific patterns

  • Phosphorylation pathway analysis: Investigate potential alternative kinases that might phosphorylate WalR in the absence of WalK, particularly in contexts where WalK depletion has minimal phenotypic effects

What methodological approaches can be used to identify the environmental signals sensed by WalK in different staphylococcal species?

Identifying the environmental signals sensed by WalK remains one of the most challenging aspects of research on this protein. Several methodological approaches can be employed:

1. Domain-swapping experiments:

  • Generate chimeric proteins with sensor domains from different species

  • Test response to various environmental conditions

  • Identify conditions that trigger differential activation based on sensor domain origin

2. Site-directed mutagenesis of extracellular domains:

  • Create point mutations in potential ligand-binding regions

  • Assess impact on WalK activity in vitro and in vivo

  • Use computational prediction tools to identify potential binding pockets

3. Metabolomic screening:

  • Expose bacteria to different metabolites or culture supernatants

  • Monitor WalK phosphorylation state or WalR-dependent gene expression

  • Fractionate active supernatants to identify specific signaling molecules

4. Crystallography and structural biology:

  • Determine crystal structures of WalK extracellular domains

  • Perform co-crystallization with potential ligands

  • Use molecular dynamics simulations to identify potential binding events

5. Transcriptomic and phosphoproteomic analysis:

  • Compare WalK/WalR activity under diverse environmental conditions

  • Identify conditions that alter the WalK phosphorylation state

  • Correlate with changes in WalR-dependent gene expression

6. Chemical genetics approaches:

  • Screen chemical libraries for compounds that modulate WalK activity

  • Use structure-activity relationships to infer natural ligand properties

  • Develop biosensor strains with reporter genes linked to WalK-WalR activity

These approaches should be applied across multiple staphylococcal species to identify both conserved and species-specific sensing mechanisms, potentially revealing adaptations to different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.