Recombinant Staphylococcus haemolyticus Signal transduction histidine-protein kinase ArlS (arlS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
arlS; SH1491; Signal transduction histidine-protein kinase ArlS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
arlS
Target Protein Sequence
MIKKGTLKYKWMMITTLIMFSTIILFCLVIIFFLKDTLRDGEIDEAEHSSSEIVNLVESR SMNNITTLDLTAMLENFEKAIIYDRNGKQLMQSSNENMINFKPDIDFVDPETIQISKHNG IPYLIITEPIHSERFEGYSVLIHSLEGYNNVVRSLYFVAIAFGLLATFIMAGISYIFSTQ LTKPLVTMSNKMIQIRRDGFQNKLELKTNYEETDNLIDTFNDMMYQIEESFNQQRQFVED ASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISLEEMNRITKLVEELLLLTKDKVN IQALEFEEVNINEEIRSRIKSLKQLHPDYQFKTHLSKKPLTLQINRHQFEQLLLIFIDNA MKYDKDNKQIEIATQLRNKQISIEITDHGLGIPKEDQEFIFDRFYRVDKSRSRSQGGNGL GLFIAEKIVQQYGGYITVDSEVNQYTTFKIIFK
Uniprot No.

Target Background

Function
ArlS is a member of the two-component ArlS/ArlR regulatory system. It functions as a sensor histidine kinase, autophosphorylating at a histidine residue before transferring the phosphate group to ArlR.
Database Links

KEGG: sha:SH1491

STRING: 279808.SH1491

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of ArlS in Staphylococcus haemolyticus?

ArlS functions as a sensor histidine kinase in S. haemolyticus that forms part of the ArlRS two-component system (TCS). Based on comparative studies with S. aureus, ArlS likely senses environmental signals such as nutrient availability and metal limitation, and transmits these signals by phosphorylating its cognate response regulator ArlR. This phosphorylation activates ArlR, which then regulates the expression of genes involved in bacterial adaptation to environmental stresses, particularly those related to host-imposed manganese starvation and glucose limitation . In pathogenic contexts, the ArlRS system appears to be critical for S. haemolyticus to respond to host defense mechanisms, particularly calprotectin-mediated metal sequestration.

How does the structure of ArlS contribute to its function?

ArlS in S. haemolyticus, like other sensor histidine kinases, has a modular structure consisting of a sensory domain that detects environmental signals and a kinase domain that catalyzes the transfer of a phosphoryl group to its cognate response regulator. The sensor domain likely contains specific motifs that interact with environmental cues such as changes in metabolic intermediates during glucose limitation . The catalytic core contains a conserved histidine residue that becomes autophosphorylated when the sensor domain detects appropriate signals. This phosphoryl group is subsequently transferred to a conserved aspartate residue (D52) in the receiver domain of ArlR , activating its function as a transcriptional regulator. This structural arrangement allows for precise signal transduction from extracellular conditions to transcriptional responses.

What is known about ArlS expression in different S. haemolyticus strains?

While specific data on ArlS expression across different S. haemolyticus strains is limited in the provided search results, we can infer potential patterns based on the genetic diversity observed in S. haemolyticus populations. The emerging multidrug-resistant ST42 clone of S. haemolyticus shows significant genomic differences compared to other sequence types, including the possession of more virulence genes and antibiotic resistance determinants . Given the importance of two-component systems like ArlRS in bacterial adaptation, there may be strain-specific variations in ArlS expression or function, particularly between dominant clinical strains like ST42 and other lineages. This variability could contribute to the enhanced virulence and antibiotic resistance observed in certain S. haemolyticus clones.

What are the best methods for recombinant expression of S. haemolyticus ArlS?

For recombinant expression of S. haemolyticus ArlS, researchers should consider the following methodological approach:

  • Vector selection: Use pET-based expression systems with T7 promoters for high-level expression in E. coli BL21(DE3) or Rosetta strains.

  • Construct design: Include:

    • A 6xHis or other affinity tag for purification

    • A TEV protease cleavage site for tag removal

    • Codon optimization for E. coli expression

  • Expression conditions:

    • Induce with 0.1-0.5 mM IPTG

    • Lower temperature (16-25°C) during induction to enhance proper folding

    • Supplement with glycerol (5-10%) to stabilize membrane-associated domains

  • Purification strategy:

    • Solubilize membrane fractions with mild detergents (DDM or CHAPS)

    • Use immobilized metal affinity chromatography followed by size exclusion chromatography

    • Include phosphatase inhibitors to preserve phosphorylation state if required

This approach has been successful for similar histidine kinases and should yield functionally active recombinant ArlS protein suitable for biochemical and structural studies .

How can researchers assess ArlS phosphorylation activity in vitro?

To assess the phosphorylation activity of recombinant ArlS in vitro, researchers should implement the following protocol:

  • Autophosphorylation assay:

    • Incubate purified ArlS (1-5 μM) with ATP (50-200 μM) containing [γ-32P]ATP

    • Reaction buffer: 50 mM Tris-HCl (pH 8.0), 50 mM KCl, 10 mM MgCl2, 0.1 mM EDTA

    • Incubate at 25°C for 5-30 minutes

    • Terminate reaction with SDS sample buffer

    • Analyze by SDS-PAGE followed by autoradiography or phosphorimaging

  • Phosphotransfer to ArlR:

    • Pre-phosphorylate ArlS as above

    • Add equimolar purified ArlR

    • Incubate for various timepoints (30 seconds to 30 minutes)

    • Analyze transfer of 32P from ArlS to ArlR by SDS-PAGE and autoradiography

  • Alternative non-radioactive approach:

    • Use Phos-tag™ SDS-PAGE to detect phosphorylated proteins

    • Western blot with phospho-histidine antibodies

    • Mass spectrometry to identify phosphorylated residues

These methods allow quantitative assessment of both autophosphorylation kinetics and phosphotransfer efficiency to the cognate response regulator ArlR .

What reporter systems can be used to monitor ArlS-ArlR pathway activation in vivo?

Several reporter systems can be effectively deployed to monitor ArlS-ArlR pathway activation in bacterial cells:

  • Transcriptional fusions:

    • Construction of promoter-reporter fusions using ArlR-regulated promoters (e.g., mgrA-P2) linked to:

      • Luciferase (lux) for real-time measurements

      • β-galactosidase (lacZ) for end-point assays

      • Fluorescent proteins (GFP, mCherry) for single-cell analysis

    • These constructs allow quantitative assessment of ArlR activation in response to various stimuli

  • Engineered proteolytic release systems:

    • A transcription factor tethered to a membrane-bound receptor with a protease cleavage site

    • Upon activation, the transcription factor is cleaved and released to activate reporter genes

    • This approach provides high selectivity and sensitivity for monitoring protein interactions

  • FRET-based sensors:

    • Fusion of fluorescent protein pairs to ArlS and ArlR

    • Changes in FRET signal indicate direct interaction between the two proteins

    • Allows real-time monitoring of TCS activation in living cells

Each system offers distinct advantages for different experimental questions, with transcriptional fusions being most commonly used for studying ArlRS pathway activation in response to stimuli like calprotectin or glucose limitation .

How does ArlS in S. haemolyticus compare to its homologs in other Staphylococcal species?

A comparative analysis of ArlS across Staphylococcal species reveals important evolutionary and functional relationships:

SpeciesSequence Identity to S. haemolyticus ArlSKey Functional DifferencesRole in Virulence
S. aureus~75-80% (estimated)Well-characterized response to calprotectin and glucose limitationCritical for resistance to metal starvation and virulence
S. epidermidis~82-87% (estimated)Less studied; likely involved in biofilm formationAssociated with biofilm-related infections
S. saprophyticus~70-75% (estimated)Putative role in urinary tract adaptationLess defined role in pathogenesis
S. lugdunensis~72-78% (estimated)Unknown functional specificityEmerging pathogen with virulence mechanisms under investigation

What is the relationship between ArlS function and antibiotic resistance in S. haemolyticus?

The relationship between ArlS function and antibiotic resistance in S. haemolyticus represents a complex interplay between signal transduction and adaptive responses:

  • Regulatory networks: ArlS-ArlR likely regulates genes involved in cell envelope integrity and modification, which can influence susceptibility to antibiotics targeting cell wall synthesis or membrane function. In S. aureus, the ArlRS system affects genes involved in the response to host-imposed stresses like metal limitation , which may overlap with mechanisms of antibiotic resistance.

  • ST42 clone implications: The ST42 clone of S. haemolyticus exhibits decreased susceptibility to multiple antibiotics and carries significantly more antibiotic resistance genes (ARGs) than other sequence types . While direct evidence linking ArlS to this enhanced resistance profile is limited, two-component systems like ArlRS often regulate stress responses that can contribute to antibiotic tolerance.

  • Potential mechanisms: ArlS may influence antibiotic resistance through:

    • Regulation of efflux pump expression

    • Modulation of cell wall thickness or composition

    • Coordination of general stress responses that enhance survival during antibiotic exposure

    • Cross-talk with other regulatory systems involved in antimicrobial resistance

  • Metal homeostasis connection: Given ArlS's role in responding to metal limitation in S. aureus , alterations in metal ion homeostasis regulated by ArlS could affect the activity of metal-dependent antibiotics or detoxification systems.

Understanding these relationships could potentially identify ArlS as a target for adjuvant therapies designed to enhance antibiotic efficacy against multidrug-resistant S. haemolyticus strains.

How does the phosphorylation state of ArlS affect downstream signaling cascades in S. haemolyticus?

The phosphorylation state of ArlS orchestrates a sophisticated signaling cascade that regulates gene expression patterns in response to environmental cues:

  • Signal integration mechanism: Upon sensing specific stimuli (likely related to metal availability or glucose limitation based on S. aureus studies ), ArlS undergoes ATP-dependent autophosphorylation at a conserved histidine residue. This represents the initial signal integration event that converts environmental information into a biochemical signal.

  • Phosphotransfer dynamics: The phosphoryl group from the phosphorylated histidine residue of ArlS is transferred to a conserved aspartate residue (D52) in the receiver domain of ArlR . This phosphotransfer event is critical for signal propagation, as evidenced by the finding that a D52A mutation in ArlR prevents activation in response to calprotectin in S. aureus .

  • Activation threshold effects: Interestingly, in S. aureus, the loss of ArlS does not completely eliminate ArlR activity but renders it unresponsive to stimuli like calprotectin and glucose limitation . This suggests a basal level of ArlR phosphorylation may occur through:

    • Cross-talk with other histidine kinases (potentially GraS )

    • Small molecule phosphodonors

    • Residual ArlR activity in the unphosphorylated state

  • Temporal regulation: The phosphorylation state of ArlS likely exhibits temporal dynamics that shape the duration and magnitude of downstream responses. ArlS-specific phosphatases or intrinsic dephosphorylation rates would determine signal termination, affecting how quickly the system returns to baseline after stimulus removal.

This sophisticated phosphorylation control mechanism allows for precise regulation of gene expression in response to changing environmental conditions, contributing to the adaptability and pathogenicity of S. haemolyticus.

How might targeting ArlS affect virulence of multidrug-resistant S. haemolyticus strains?

Targeting ArlS in multidrug-resistant S. haemolyticus strains, particularly the emerging ST42 clone, represents a promising approach to attenuate virulence while potentially circumventing antibiotic resistance mechanisms:

This approach aligns with the growing interest in targeting bacterial virulence and stress adaptation rather than essential functions as an alternative strategy against multidrug-resistant pathogens.

What clinical significance does ArlS have in the context of hospital-acquired S. haemolyticus infections?

The clinical significance of ArlS in hospital-acquired S. haemolyticus infections stems from its potential role in adaptation to healthcare environments and contribution to pathogenesis:

  • Environmental adaptation: S. haemolyticus ST42 has been found widely disseminated in hospital environments . If ArlS functions similarly to its S. aureus homolog, it likely contributes to sensing and adapting to hospital-specific conditions, including:

    • Fluctuating nutrient availability

    • Exposure to disinfectants and antiseptics

    • Metal limitation in specific microenvironments

  • Host niche colonization: S. haemolyticus strains have been isolated from multiple patient sources, including nares, feces, and bronchoalveolar lavage fluid . ArlS-mediated sensing and adaptation may facilitate colonization of these diverse host niches, contributing to persistent carriage and subsequent infection.

  • Biofilm formation: 56.7% of S. haemolyticus strains can form biofilms, with glucose enhancing this ability in certain strains . If ArlS is involved in sensing glucose availability, as in S. aureus , it may contribute to biofilm formation on medical devices, a major factor in healthcare-associated infections.

  • Multidrug resistance: The ST42 clone of S. haemolyticus exhibits decreased susceptibility to multiple antibiotics commonly used in healthcare settings, including oxacillin and clindamycin . ArlS may contribute to this resistance profile through regulation of stress responses that enhance survival during antibiotic exposure.

  • Emerging threat assessment: S. haemolyticus is described as "an emerging opportunistic pathogen with a high burden of antimicrobial resistance" . Understanding ArlS function could help predict the adaptive capacity and virulence potential of emerging strains, informing surveillance and infection control strategies.

This clinical context underscores the importance of studying ArlS not just as a basic research target but as a factor in the public health challenge posed by hospital-acquired S. haemolyticus infections.

What innovative approaches could be used to study ArlS-ArlR cross-talk with other two-component systems?

To investigate the complex cross-talk between ArlS-ArlR and other two-component systems (TCS) in S. haemolyticus, researchers should consider these innovative methodological approaches:

  • Phosphoproteomics with kinase-specific enrichment:

    • IMAC-based enrichment of phosphorylated proteins following stimulus exposure

    • MS/MS analysis with neutral loss scanning for histidine and aspartate phosphorylation

    • Quantitative comparison between wild-type and arlS/arlR mutants to identify non-canonical phosphorylation events

    • This approach could identify response regulators phosphorylated by ArlS or histidine kinases that phosphorylate ArlR

  • Protein-protein interaction mapping:

    • Proximity-based labeling (BioID or TurboID) with ArlS/ArlR as bait proteins

    • FRET/BRET biosensors designed to detect specific TCS interactions

    • Label-free quantitative interactomics under various stress conditions

    • These methods could identify direct interactions between ArlS/ArlR and components of other TCS

  • Genetic synthetic interaction screens:

    • Creation of a comprehensive library of S. haemolyticus TCS component deletions

    • Systematic double-knockout analysis to identify genetic interactions

    • Phenotypic profiling using growth, virulence, and resistance assays

    • Synthetic genetic array (SGA) analysis to map the TCS interaction network

  • In vitro reconstitution systems:

    • Development of a protein-based in vitro system similar to the approach described in reference

    • Testing of phosphotransfer between purified non-cognate histidine kinases and response regulators

    • Quantitative measurement of kinetic parameters for cognate vs. non-cognate pairs

    • This would provide direct biochemical evidence for cross-talk potential

These approaches would significantly advance our understanding of the complex signaling network involving ArlS-ArlR and other TCS in S. haemolyticus, potentially revealing new therapeutic targets and regulatory mechanisms.

How might structural studies of ArlS inform the development of specific inhibitors?

Structural studies of ArlS would provide critical insights for rational inhibitor design through the following methodological approach:

  • Full-length and domain-specific structural determination:

    • X-ray crystallography of individual domains (sensor, DHp, CA)

    • Cryo-EM of full-length ArlS to capture conformational dynamics

    • NMR studies of sensor domain-ligand interactions

    • Molecular dynamics simulations to identify allosteric sites

  • Structure-based inhibitor design targeting specific functional sites:

    • ATP-binding pocket inhibitors to block autophosphorylation

    • Allosteric inhibitors that prevent conformational changes

    • Sensor domain antagonists that interfere with signal detection

    • Dimerization interface disruptors to prevent functional complex formation

  • Critical structural features for targeting:

    • The conserved histidine residue in the DHp domain that undergoes autophosphorylation

    • The sensor domain that detects environmental signals like metal limitation

    • The interface between ArlS and ArlR that mediates phosphotransfer

    • Conformational switches that regulate kinase activity

  • Fragment-based approach:

    • Screening of fragment libraries against ArlS structural domains

    • Structure-activity relationship development

    • Fragment growing, linking, and optimization

    • In silico docking to guide compound refinement

  • Comparative analysis across species:

    • Structural comparison between ArlS from S. haemolyticus, S. aureus, and other pathogens

    • Identification of species-specific structural features

    • Design of selective inhibitors targeting S. haemolyticus-specific elements

    • Cross-species activity profiling of lead compounds

This methodical structural biology approach would significantly advance the development of specific ArlS inhibitors with potential therapeutic applications against multidrug-resistant S. haemolyticus infections.

What genomic approaches could identify ArlS-regulated genes specific to S. haemolyticus?

To comprehensively identify ArlS-regulated genes in S. haemolyticus, researchers should implement the following integrated genomic approach:

  • Comparative transcriptomics:

    • RNA-Seq analysis comparing wild-type, ΔarlS, and ΔarlR strains under:

      • Standard laboratory conditions

      • Metal-limited conditions (calprotectin exposure)

      • Glucose limitation

      • Host-relevant conditions (serum, macrophage co-culture)

    • Time-course analysis to capture both immediate and adaptive responses

    • Statistical analysis to identify directly and indirectly regulated genes

    • This approach would reveal the ArlS-dependent transcriptome under various conditions

  • Chromatin immunoprecipitation sequencing (ChIP-Seq):

    • Generation of epitope-tagged ArlR or phosphorylation-specific antibodies

    • ChIP-Seq to identify genome-wide ArlR binding sites

    • Motif analysis to define the ArlR recognition sequence

    • Integration with transcriptomic data to distinguish direct vs. indirect regulation

  • Transposon insertion sequencing (Tn-Seq):

    • Creation of saturated transposon libraries in wild-type and ΔarlS backgrounds

    • Selection under various stresses relevant to ArlS function

    • Identification of genetic interactions revealing functional connections

    • This approach would identify genes whose importance is conditional on ArlS status

  • Comparative genomic analysis across strains:

    • Analysis of ArlR binding site conservation in different S. haemolyticus strains

    • Correlation with virulence and resistance profiles

    • Special focus on the ST42 clone with its enhanced virulence and resistance

    • Identification of strain-specific regulon members

  • Data integration strategy:

    • Construction of an ArlS/ArlR regulon model integrating all datasets

    • Network analysis to identify regulatory hubs and feedback mechanisms

    • Comparison with known ArlS/ArlR regulons in S. aureus

    • Experimental validation of key regulatory relationships

This comprehensive genomic approach would provide unprecedented insight into the ArlS regulon in S. haemolyticus, revealing potential targets for therapeutic intervention and advancing our understanding of signal transduction in this emerging pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.