Recombinant Staphylococcus haemolyticus UPF0316 protein SH1041 (SH1041)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Staphylococcus haemolyticus UPF0316 protein SH1041 (SH1041) is a bioengineered protein derived from the UPF0316 family, a group of uncharacterized proteins in prokaryotic genomes. The protein is encoded by the SH1041 gene (UniProt ID: Q4L7M5) and spans 202 amino acids (1–202). It is produced via heterologous expression in Escherichia coli, with an N-terminal His tag for purification .

Key Features

ParameterValue
Gene NameSH1041
Protein LengthFull-length (1–202 aa)
TagN-terminal His tag
SourceStaphylococcus haemolyticus (strain JCSC1435 or similar)
Purity>90% (SDS-PAGE)
StorageLyophilized powder (store at -20°C/-80°C); reconstitute in water

Production and Purification

SH1041 is synthesized in E. coli and purified using His-tag affinity chromatography. The final product is lyophilized in a Tris/PBS-based buffer with 6% trehalose (pH 8.0) to enhance stability .

Purification Workflow

  1. Expression: Induced in E. coli under optimized conditions.

  2. Cell Lysis: Harvested bacterial pellets are lysed to release intracellular proteins.

  3. Affinity Chromatography: His-tagged SH1041 binds to nickel columns, eluted with imidazole.

  4. Lyophilization: Concentrated protein is freeze-dried for long-term storage.

Comparative Genomic and Functional Insights

Genomic studies of S. haemolyticus highlight its adaptation to clinical environments, including antibiotic resistance and biofilm formation . While SH1041 itself is not explicitly linked to these traits, its classification as a UPF0316 protein suggests potential roles in:

  • Cell Wall Integrity: Similar to LPXTG-motif proteins (e.g., Atl, SceD) critical for peptidoglycan remodeling .

  • Horizontal Gene Transfer: UPF0316 genes may be acquired via plasmids or phages, as seen in ermC resistance genes .

Clinical vs. Commensal Strains

TraitClinical IsolatesCommensal Isolates
Antibiotic ResistanceHigh (e.g., mecA, aacA-aphD) Low
Biofilm FormationHigher trend Lower adhesion to fibronectin/collagen
Surface ProteinsDiverse LPXTG/LPXAG domains Limited surface protein expression

Future Research Directions

  1. Functional Characterization: Determine SH1041’s role in bacterial physiology or pathogenesis.

  2. Interaction Mapping: Identify host-cell receptors or bacterial partners using proteomics.

  3. Therapeutic Targeting: Assess SH1041 as a candidate for vaccines or antibody-based therapies.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SH1041; UPF0316 protein SH1041
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
SH1041
Target Protein Sequence
MSVITSNPWSMVLAIFVINVFYVTFLTMRTILTLKGYRYMAAAVSFLEVLVYVVGLGMVM SSLDQIQNIFAYAFGFSIGILVGMKIEEKLALGYTVVNVTSSEYEIDLPNELRNLGYGVT HYAAHGRDGSRMVMQILTPRRYERKLMETVRNLDEKAFIIAYEPRAIHGGFWTKGVRTRK VKAYEVEEIESVVEHDDEVQSK
Uniprot No.

Target Background

Database Links

KEGG: sha:SH1041

STRING: 279808.SH1041

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SH1041 protein and what organism does it originate from?

SH1041 is a UPF0316 family protein originating from the bacterium Staphylococcus haemolyticus. S. haemolyticus is a skin commensal organism that has emerged as a significant nosocomial pathogen . The recombinant form typically refers to the full-length protein (202 amino acids) expressed heterologously in E. coli with an N-terminal His-tag . The protein is identified in UniProt under the accession number Q4L7M5 .

What are the physicochemical properties of recombinant SH1041?

Recombinant SH1041 is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . The protein is stable when stored properly, though repeated freeze-thaw cycles should be avoided. Key properties include:

PropertyCharacteristic
Length202 amino acids
TagN-terminal His-tag
Expression systemE. coli
SolubilitySoluble in Tris/PBS-based buffer
Storage formLyophilized powder
Purity>90% (SDS-PAGE)
Storage conditions-20°C/-80°C

What is the recommended protocol for reconstitution and storage of SH1041?

For optimal results when working with recombinant SH1041, follow these methodological guidelines:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution .

How can researchers verify the quality and integrity of reconstituted SH1041?

Multiple analytical methods should be employed to assess protein quality:

  • SDS-PAGE to confirm molecular weight and purity

  • Western blotting using anti-His antibodies to verify the presence of the His-tag

  • Mass spectrometry to confirm protein identity and detect potential modifications

  • Size exclusion chromatography to assess aggregation state

  • Circular dichroism to evaluate secondary structure integrity

Any deviation from expected results may indicate protein degradation or misfolding, which could affect experimental outcomes.

What is the known or predicted function of SH1041 in S. haemolyticus?

  • The protein may function as a membrane-associated protein based on its hydrophobic regions

  • It could potentially be involved in bacterial cell wall processes or membrane integrity

  • It might play a role in bacterial adaptation to environmental stresses

Research comparing S. haemolyticus surface proteins has identified numerous proteins involved in bacterial adhesion, colonization, and biofilm formation . While SH1041 was not specifically highlighted in these studies, its membrane localization suggests potential involvement in bacterial surface interactions.

What experimental approaches are recommended to investigate SH1041 function?

To elucidate the function of SH1041, researchers should consider these methodological approaches:

  • Gene knockout/knockdown studies: Create SH1041-deficient S. haemolyticus strains and assess phenotypic changes in:

    • Growth kinetics

    • Membrane integrity

    • Stress responses

    • Biofilm formation capacity

  • Protein interaction studies:

    • Pull-down assays using His-tagged SH1041 to identify binding partners

    • Bacterial two-hybrid screens

    • Co-immunoprecipitation followed by mass spectrometry

  • Localization studies:

    • Immunofluorescence microscopy

    • Cell fractionation followed by Western blotting

    • Cryo-electron microscopy

  • Structural studies:

    • X-ray crystallography or NMR to determine three-dimensional structure

    • Molecular dynamics simulations to predict functional domains

How might SH1041 contribute to S. haemolyticus virulence and host interaction?

S. haemolyticus is an emerging nosocomial pathogen, and understanding its virulence factors is crucial for developing therapeutic strategies . While SH1041's specific role in virulence is not yet established, several potential contributions can be investigated:

  • Surface protein functionality: If SH1041 is expressed on the bacterial surface, it may contribute to adhesion to host tissues or medical devices, a critical first step in infection

  • Biofilm formation: S. haemolyticus is known to form biofilms, which contribute to antibiotic resistance and persistent infections. Surface proteins often play key roles in biofilm development and maturation

  • Immune evasion: Some staphylococcal surface proteins interfere with host immune responses. Similar functions could be investigated for SH1041

Research on S. haemolyticus has identified 65 surface proteins involved in adhesion and biofilm formation, including elastin binding protein (EbpS) and several LPXTG domain-containing proteins . Comparative studies could reveal functional similarities between SH1041 and these known virulence factors.

What methodologies are recommended for studying SH1041 in host-pathogen interaction models?

To investigate the role of SH1041 in host-pathogen interactions, researchers should consider these approaches:

  • Cell culture infection models:

    • Keratinocyte (HaCaT) colonization assays to mimic skin interaction

    • Comparison of wildtype and SH1041-deficient strains in adhesion assays

    • Quantification of bacterial internalization and persistence

  • Biofilm assays:

    • Static and dynamic biofilm formation assays

    • Confocal microscopy to assess biofilm architecture

    • Anti-biofilm agent susceptibility testing

  • Proteomics approaches:

    • Bacterial surface shaving followed by mass spectrometry to confirm SH1041 surface exposure under different conditions

    • Comparative proteomics between planktonic and biofilm growth modes

    • Protein expression analysis after host cell contact

  • Immune response studies:

    • Assessment of inflammatory cytokine production in response to recombinant SH1041

    • Neutrophil activation and phagocytosis assays

    • Complement activation studies

How can structural characterization of SH1041 inform therapeutic development?

Detailed structural characterization of SH1041 could provide insights for developing novel antimicrobial strategies:

  • Structure-based drug design: If SH1041 plays a crucial role in bacterial survival or virulence, its structure could inform the design of specific inhibitors

  • Epitope mapping: Identifying immunogenic regions of SH1041 could guide vaccine development efforts

  • Protein engineering: Modification of SH1041 could potentially create diagnostic tools or therapeutic delivery systems

Recent studies have highlighted surface proteins as potential targets for antimicrobial treatment and diagnostics . The identification of expressed proteins after host-microbe interaction offers tools for the discovery and design of novel antimicrobial approaches.

What comparative genomic approaches could enhance our understanding of SH1041 evolution?

Evolutionary analysis of SH1041 across staphylococcal species could reveal important insights:

  • Phylogenetic analysis: Comparing SH1041 homologs across staphylococcal species to understand evolutionary conservation and divergence

  • Selection pressure analysis: Identifying regions under positive or negative selection to infer functional importance

  • Horizontal gene transfer assessment: Investigating whether SH1041 shows evidence of acquisition through horizontal gene transfer

  • Structural comparison: Comparing predicted structures of SH1041 homologs to identify conserved structural features

These approaches could reveal whether SH1041 has evolved species-specific functions or maintained conserved roles across staphylococcal species.

What are common challenges in expressing and purifying recombinant SH1041?

Researchers working with recombinant SH1041 may encounter several technical challenges:

  • Expression optimization: Membrane proteins often require specialized expression systems. Consider:

    • Testing different E. coli strains optimized for membrane protein expression

    • Varying induction conditions (temperature, IPTG concentration, induction time)

    • Using solubility-enhancing fusion partners

    • Screening different detergents for membrane protein extraction

  • Purification challenges:

    • Optimizing imidazole concentrations in His-tag purification to reduce non-specific binding

    • Implementing additional purification steps (ion exchange, size exclusion chromatography)

    • Testing different buffer compositions to enhance stability

  • Protein activity assessment:

    • Developing functional assays to verify that the recombinant protein retains native activity

    • Comparing properties of different tag positions (N-terminal vs. C-terminal)

How can contradictory experimental results with SH1041 be reconciled?

When facing contradictory results in SH1041 research, consider these methodological approaches:

  • Experimental variability sources:

    • Batch-to-batch variation in recombinant protein preparation

    • Differences in bacterial strains and growth conditions

    • Variation in host cell models and passage number

  • Data integration strategies:

    • Meta-analysis of multiple experimental approaches

    • Replication with standardized protocols across different laboratories

    • Careful control of environmental variables

  • Resolution approaches:

    • Developing quantitative assays with internal controls

    • Using multiple complementary techniques to address the same question

    • Implementing appropriate statistical analyses for complex datasets

What emerging technologies could advance our understanding of SH1041 function?

Several cutting-edge technologies could significantly enhance SH1041 research:

  • CRISPR-Cas9 genome editing:

    • Precise modification of the SH1041 gene to study structure-function relationships

    • Creation of reporter fusions to monitor expression patterns

    • Generation of conditional knockouts to study essential functions

  • Cryo-electron microscopy:

    • High-resolution structural determination of membrane-embedded SH1041

    • Visualization of protein-protein interactions in native membrane environment

  • Advanced proteomics:

    • Thermal proteome profiling to identify binding partners

    • Protein-protein interaction mapping using proximity labeling techniques

    • Quantitative proteomics to assess expression under different conditions

  • Single-cell techniques:

    • Single-cell RNA-seq to examine expression heterogeneity

    • Time-lapse microscopy to track protein localization during infection processes

What integrative approaches could link SH1041 to broader S. haemolyticus biology?

To place SH1041 in the broader context of S. haemolyticus biology, researchers should consider:

  • Systems biology approaches:

    • Network analysis to identify functional modules containing SH1041

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Mathematical modeling of protein interactions and signaling pathways

  • Comparative analysis across conditions:

    • Expression profiling during different growth phases

    • Response to antimicrobial treatments

    • Adaptation to host environments

  • Multi-omics integration:

    • Correlation of genomic variations with proteome changes

    • Linking metabolic shifts to protein expression patterns

    • Connecting structural variations to functional consequences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.