Recombinant Staphylococcus haemolyticus UPF0365 protein SH1343 (SH1343)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
floA; SH1343; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Staphylococcus haemolyticus (strain JCSC1435)
Target Names
SH1343
Target Protein Sequence
MFGLGIIVIAVIIVIALLVLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVIGP LIKAHKAGLNLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLE AVQMSVNPKVIETPFITGVAMNGIEVKAKARITVRANISRLVGGSGEETIIARVGEGIVS TIGSSEHHTQVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDIGKNIGADLQTEQALA DKNIAQAKAEERRAMAVASEQEMKARVQEMRAKVVEAESEVPLAMAEALREGNLGVKDYY NLKNVEADTGMRNAINKRTEQNEDESPK
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered crucial regulators of membrane fluidity.

Database Links

KEGG: sha:SH1343

STRING: 279808.SH1343

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What expression systems yield optimal results for SH1343 protein production?

For recombinant expression of SH1343, E. coli systems typically yield the highest protein amounts with shorter production times. The methodology involves:

  • Cloning the full-length coding sequence into an appropriate expression vector with a His-tag

  • Expression in E. coli under optimal induction conditions

  • Purification via affinity chromatography

  • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For applications requiring post-translational modifications, expression in insect cells with baculovirus or mammalian cell systems is recommended, though with lower yields. When designing expression constructs, consider codon optimization for the chosen host system to improve expression efficiency .

What are the optimal conditions for storage and handling of recombinant SH1343?

For optimal stability and activity retention:

  • Store the purified protein at -20°C/-80°C in aliquots to prevent repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

  • Use buffer systems containing 50% glycerol or 6% trehalose for long-term storage

  • Reconstitute lyophilized protein to 0.1-1.0 mg/mL in deionized sterile water

  • After reconstitution, add glycerol to a final concentration of 50% for cryoprotection

Repeated freeze-thaw cycles significantly reduce protein activity, so single-use aliquots are strongly recommended for experimental reproducibility .

What is known about the functional role of SH1343 in Staphylococcus haemolyticus?

The functional role of SH1343 remains incompletely characterized, but several lines of evidence suggest it may function in:

  • Membrane organization and microdomain formation (based on its flotillin-like classification)

  • Potential involvement in antibiotic resistance mechanisms

  • Possible role in biofilm formation

S. haemolyticus contains numerous surface proteins involved in adhesion and virulence. While SH1343 was not specifically identified among the 65 surface proteins characterized in comparative studies between clinical and commensal strains, its structural similarities to other membrane proteins suggest potential involvement in host-pathogen interactions .

Research comparing protein expression patterns between bacterial growth in standard media versus human keratinocyte colonization models would be valuable to determine if SH1343 is differentially expressed during host interaction .

How does SH1343 compare structurally and functionally with homologous proteins in other Staphylococcal species?

Comparative genomic analyses indicate that UPF0365 family proteins are conserved across many Staphylococcal species but with varying sequence homology. Structural predictions suggest:

  • The presence of transmembrane domains is conserved across the protein family

  • The C-terminal region shows higher conservation than the N-terminal region

  • Functional differences may correlate with the clinical versus commensal nature of different strains

When conducting comparative studies, researchers should consider both sequence alignment and structural prediction analyses. Particularly notable is that S. haemolyticus contains distinctive surface protein variants compared to S. aureus and S. epidermidis, which may contribute to its specific pathogenic mechanisms and niche adaptation .

What methodologies are most effective for studying protein-protein interactions involving SH1343?

For investigating protein-protein interactions of SH1343, consider these methodologies:

  • Bacterial Surface Shaving: This proteomics approach involves limited proteolysis of intact bacterial cells with trypsin to release surface-exposed peptides, followed by MS analysis. This has been successfully employed with S. haemolyticus and can identify proteins co-localized with SH1343 .

  • Co-immunoprecipitation with TMT Labeling: Using antibodies against the recombinant SH1343 protein to pull down interaction partners, followed by tandem mass tag (TMT) labeling for relative quantification by mass spectrometry. This allows comparative analysis of interaction partners under different conditions .

  • Bacterial Two-Hybrid Systems: Adapted for membrane proteins to identify potential interaction partners from genomic libraries.

  • Proximity-Based Labeling: Methods such as BioID or APEX2 can be adapted for bacterial systems to identify proteins in close proximity to SH1343 in living cells.

When designing these experiments, consider comparing interaction networks between clinical and commensal strains to identify pathogenicity-associated interactions .

How does genomic plasticity in S. haemolyticus affect SH1343 expression and function?

S. haemolyticus exhibits remarkable genomic plasticity, characterized by frequent genomic rearrangements and a high number of insertion sequences (IS). Research has shown:

  • S. haemolyticus JCSC1435 contains up to 82 insertion sequences in its chromosome

  • Genomic rearrangements occur preferentially near the origin of replication

  • These rearrangements can affect antibiotic resistance and metabolism genes

To study how this genomic plasticity affects SH1343 expression:

  • Compare SH1343 sequence variations across multiple clinical and commensal isolates

  • Analyze the gene's chromosomal location relative to known hotspots for genomic rearrangements

  • Monitor expression levels of SH1343 in isolates with different genomic organizations

  • Evaluate potential horizontal gene transfer events involving this gene

This genomic plasticity may contribute to variations in SH1343 expression or function across different lineages, potentially correlating with pathogenicity and adaptation to hospital environments .

What is the evolutionary significance of SH1343 in the context of S. haemolyticus adaptation to hospital environments?

Evolutionary analysis suggests SH1343 may play a role in S. haemolyticus adaptation to clinical settings. Research indicates:

  • S. haemolyticus clinical isolates show clear phylogenetic clustering distinct from commensal strains

  • Hospital-adapted strains acquire specific genetic signatures through horizontal gene transfer and beneficial mutations

  • Membrane proteins may be under selective pressure in the hospital environment

Methodologies to study evolutionary patterns include:

  • Comparative genomics across temporal and geographical collections of isolates

  • Analysis of selection pressures on the SH1343 gene using dN/dS ratios

  • Investigation of SH1343 expression differences between clinical and commensal isolates

  • Functional studies under conditions mimicking hospital environments (antibiotic exposure, desiccation, etc.)

Understanding the evolutionary context of SH1343 may reveal its contribution to the successful persistence of S. haemolyticus in healthcare settings .

How can SH1343 be used in studies of biofilm formation and antibiotic resistance?

SH1343 may play a role in biofilm formation and antibiotic resistance mechanisms. To investigate this:

  • Biofilm Formation Studies:

    • Generate SH1343 knockout mutants and assess biofilm formation capacity

    • Perform crystal violet assays and scanning electron microscopy observations comparing wild-type and mutant strains

    • Examine SH1343 expression levels in planktonic versus biofilm growth conditions

  • Antibiotic Resistance Analysis:

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics in wild-type versus SH1343-modified strains

    • Investigate potential interactions between SH1343 and established resistance mechanisms such as efflux pumps

    • Study SH1343 expression changes in response to antibiotic exposure

Fusaric acid derivatives, particularly qy17, have shown inhibitory effects on S. haemolyticus biofilm formation and virulence. Testing whether these compounds affect SH1343 expression or function could provide insights into potential therapeutic approaches .

What transcriptomic approaches best reveal the regulatory networks involving SH1343?

To elucidate regulatory networks involving SH1343:

  • RNA-Seq Analysis Under Multiple Conditions:

    • Compare transcriptomic profiles between clinical and commensal isolates

    • Analyze expression patterns under conditions that mimic hospital environments

    • Study co-expression networks to identify genes regulated alongside SH1343

  • ChIP-Seq for Transcription Factor Binding:

    • Identify transcription factors that regulate SH1343 expression

    • Map binding sites across the genome to understand broader regulatory networks

  • Dual RNA-Seq During Host-Pathogen Interactions:

    • Simultaneously profile bacterial and host transcriptomes during infection models

    • Identify regulatory changes in SH1343 in response to host factors

A comprehensive approach should incorporate Gene Ontology (GO) and KEGG pathway enrichment analyses to identify biological processes and signaling pathways associated with SH1343 regulation. In previous transcriptomic studies with S. haemolyticus, treatments with antimicrobial compounds resulted in differential expression of stress response genes, virulence factors, and metabolic pathways, which may intersect with SH1343 function .

What are the most promising approaches for structural characterization of SH1343?

For structural characterization of SH1343:

  • X-ray Crystallography:

    • Express and purify large quantities of recombinant SH1343 with high purity (>95%)

    • Screen multiple crystallization conditions focusing on membrane protein-specific approaches

    • Consider using lipidic cubic phase crystallization methods appropriate for membrane proteins

  • Cryo-Electron Microscopy:

    • Particularly valuable if SH1343 forms larger complexes with other proteins

    • Suitable for membrane proteins that resist crystallization

    • May reveal dynamic structural states

  • NMR Spectroscopy:

    • Suitable for studying protein dynamics and interactions in solution

    • Requires isotopically labeled protein (15N, 13C)

    • May be challenging for full-length membrane proteins but feasible for soluble domains

  • Computational Prediction and Molecular Dynamics:

    • Use AlphaFold2 or similar tools for initial structural predictions

    • Validate predictions through experimental approaches

    • Perform molecular dynamics simulations to understand conformational flexibility

Understanding SH1343's structure would provide valuable insights into its function and potentially reveal targets for therapeutic intervention against S. haemolyticus infections .

How does SH1343 interact with host immune components during infection?

While direct evidence for SH1343's role in host-pathogen interactions is limited, research on S. haemolyticus surface proteins suggests potential mechanisms:

  • Host Cell Adhesion Studies:

    • Use recombinant SH1343 protein to assess binding to extracellular matrix components

    • Perform adhesion assays with human keratinocytes (HaCaT cells) comparing wild-type and SH1343-deficient strains

    • Investigate interactions with immune cell receptors through flow cytometry and microscopy

  • Immune Response Profiling:

    • Measure cytokine production by human immune cells exposed to purified SH1343

    • Compare immune responses to clinical versus commensal S. haemolyticus strains

    • Assess the impact of SH1343 on phagocytosis and neutrophil extracellular trap (NET) formation

  • In vivo Infection Models:

    • Develop appropriate animal models to study S. haemolyticus infections

    • Compare virulence of wild-type and SH1343-modified strains

Comparative proteomic analysis has shown that S. haemolyticus expresses different surface proteins during host cell colonization compared to growth in culture media, suggesting context-dependent regulation of virulence factors .

What methodologies best assess SH1343's potential as a vaccine target or diagnostic marker?

To evaluate SH1343 as a potential vaccine target or diagnostic marker:

  • Immunogenicity Assessment:

    • Generate recombinant SH1343 fragments representing different domains

    • Evaluate antibody responses in animal models

    • Assess conservation of epitopes across clinical isolates

  • Diagnostic Development:

    • Develop sensitive and specific antibodies against SH1343

    • Establish ELISA or lateral flow assays for detection in clinical samples

    • Evaluate sensitivity and specificity across diverse S. haemolyticus strains and related species

  • Vaccine Potential:

    • Determine protective efficacy of SH1343 immunization in appropriate animal models

    • Evaluate cellular and humoral immune responses

    • Identify specific epitopes that generate protective immunity

  • Comparative Analysis:

    • Compare SH1343 with other surface proteins identified in S. haemolyticus

    • Assess prevalence across clinical isolates from different geographical locations

    • Evaluate cross-reactivity with proteins from other staphylococcal species

Surface protein characterization studies in S. haemolyticus have identified 65 surface proteins, including several with LPXTG anchoring domains that might serve as comparative references for SH1343 evaluation .

What are common challenges in working with recombinant SH1343 and how can they be addressed?

Researchers commonly encounter these challenges when working with recombinant SH1343:

  • Low Expression Yields:

    • Optimize codon usage for the expression host

    • Test multiple expression vectors and promoter strengths

    • Explore fusion partners that enhance solubility (SUMO, MBP, etc.)

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Protein Aggregation:

    • Include mild detergents (0.1% Triton X-100 or NP-40) in purification buffers

    • Test various buffer compositions with different pH values and salt concentrations

    • Add stabilizing agents like glycerol or trehalose

    • Consider on-column refolding during purification

  • Loss of Activity During Storage:

    • Store in small single-use aliquots to prevent freeze-thaw cycles

    • Add protease inhibitors to prevent degradation

    • Include reducing agents if the protein contains cysteines

    • Test protein functionality immediately after purification and after storage

  • Purification Difficulties:

    • Optimize imidazole concentrations in wash and elution buffers

    • Try alternative affinity tags if His-tag purification is problematic

    • Consider size exclusion chromatography as a final polishing step

    • Validate protein identity and purity by mass spectrometry

For membrane-associated proteins like SH1343, including appropriate detergents during extraction and purification is critical for maintaining native conformation and functionality .

How can researchers optimize experimental design when studying the effects of SH1343 on bacterial physiology?

To design robust experiments investigating SH1343's physiological roles:

  • Genetic Manipulation Strategies:

    • Use allelic exchange methods for clean deletion of SH1343

    • Create conditional expression systems for essential genes

    • Complement mutations with plasmid-borne wild-type copies

    • Consider CRISPR interference for controlled gene knockdown

  • Phenotypic Characterization:

    • Employ multiple complementary assays for each phenotype (e.g., biofilm formation)

    • Include appropriate positive and negative controls

    • Use multiple clinical and laboratory strains to account for strain-specific effects

    • Perform time-course experiments to capture dynamic responses

  • Validation Approaches:

    • Confirm gene expression changes by RT-qPCR

    • Verify protein levels by western blot or targeted proteomics

    • Use fluorescent protein fusions to track protein localization

    • Employ complementation studies to confirm phenotype specificity

  • Statistical Considerations:

    • Ensure adequate biological replicates (minimum n=3)

    • Use appropriate statistical tests based on data distribution

    • Account for multiple testing when analyzing large datasets

    • Report effect sizes alongside p-values for biological relevance

Studies of S. haemolyticus often employ both phenotypic and genotypic approaches to characterize virulence-associated traits, as exemplified by research comparing clinical and commensal isolates .

How might SH1343 contribute to the evolution of antibiotic resistance in S. haemolyticus?

S. haemolyticus exhibits high rates of antibiotic resistance, with up to 88% of clinical isolates displaying multidrug resistance. The potential role of SH1343 in this context warrants investigation:

  • Genomic Context Analysis:

    • Examine the genomic location of SH1343 relative to mobile genetic elements

    • Assess whether SH1343 is co-transferred with resistance genes during horizontal gene transfer

    • Compare SH1343 sequences between antibiotic-resistant and susceptible isolates

  • Functional Studies:

    • Investigate whether SH1343 deletion affects minimum inhibitory concentrations

    • Test for interactions with known resistance mechanisms (efflux pumps, altered membrane permeability)

    • Examine SH1343 expression changes in response to antibiotic exposure

  • Evolutionary Analyses:

    • Study selection pressures on SH1343 in hospital environments with high antibiotic use

    • Compare evolutionary rates of SH1343 with those of known resistance determinants

    • Examine co-evolution patterns with other genes involved in adaptation to hospital environments

The high genomic plasticity of S. haemolyticus, including numerous insertion sequences and genomic rearrangements, may facilitate rapid adaptation to antibiotic selection pressure, potentially involving membrane proteins like SH1343 .

What novel therapeutic approaches might target SH1343 or its functional pathways?

Emerging strategies for targeting SH1343 or related pathways include:

  • Small Molecule Inhibitors:

    • Screen compound libraries for molecules that bind SH1343

    • Test fusaric acid derivatives, which have shown activity against S. haemolyticus

    • Develop structure-based drug design approaches once structural information is available

  • Antibody-Based Approaches:

    • Generate neutralizing antibodies against surface-exposed domains

    • Develop antibody-drug conjugates for targeted delivery

    • Explore immunotherapeutic strategies

  • Anti-Biofilm Strategies:

    • Test combinations of conventional antibiotics with SH1343 inhibitors

    • Develop biofilm-disrupting agents that may synergize with SH1343 targeting

    • Investigate quorum sensing inhibitors that might affect SH1343 expression

  • Genome Editing Technologies:

    • Explore CRISPR-based antimicrobials targeting the SH1343 gene

    • Develop phage-based delivery systems for selective targeting

Research on fusaric acid derivatives has demonstrated their ability to inhibit S. haemolyticus by disrupting biofilm formation and stress responses via altered gene expression. Similar approaches targeting SH1343-related pathways may prove effective .

CharacteristicDetails for SH1343Reference
Full protein length328 amino acids
UniProt IDQ4L6S3
Recommended storage-20°C/-80°C in Tris/PBS-based buffer with 6% Trehalose or 50% glycerol
Expression systemsE. coli (highest yield), yeast, insect cells, mammalian cells
Alternative namesFloA; Flotillin-like protein FloA
Source organismStaphylococcus haemolyticus strain JCSC1435

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.