Recombinant Staphylococcus saprophyticus subsp. saprophyticus Accessory gene regulator protein B (agrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
agrB; SSP0842; Accessory gene regulator protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
agrB
Target Protein Sequence
MVKFIDAKIDNFAKQLQQRNNLDRIEYLKMRLGMQVVVNNFFKTIVIYGVSLLCHMFLYT LTVHLTFFFIRHFAHGAHAKNSLLCYIQSVIYFVLLPWIVGYVQVSSLIMYTLALVGLII ISIYAPSATKKQPIPERLRRGKKIKAICLTLIFLLISLFLNEPYQQLMLLGIVIISILQF PIFFPKEDY
Uniprot No.

Target Background

Function
AgrB protein is essential for the production of the autoinducing peptide (AIP), a signaling molecule in the quorum sensing system. This quorum sensing system regulates the expression of virulence factor genes in Staphylococcus saprophyticus subsp. saprophyticus. AgrB is involved in the proteolytic processing of AgrD, the precursor of AIP.
Database Links

KEGG: ssp:SSP0842

STRING: 342451.SSP0842

Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the accessory gene regulator (agr) system in Staphylococci and what role does agrB play?

The accessory gene regulator (agr) system is a quorum-sensing mechanism in Staphylococci that regulates virulence gene expression in response to bacterial population density. In this system, four gene products (AgrA, AgrB, AgrC, and AgrD) work together to form a functional regulatory circuit. Specifically, AgrB is a transmembrane protein involved in the processing of the AgrD propeptide to produce an autoinducing peptide (AIP). This AIP acts as a signaling molecule that, upon reaching sufficient concentration, activates the AgrC/AgrA two-component signal transduction system. Once activated, this system positively regulates the transcription of both the P2 operon (which contains the agr genes themselves) and the P3 operon, which produces RNAIII, the primary effector molecule that regulates the expression of virulence genes . The agrB gene is therefore essential for producing the signaling molecule that initiates the entire quorum sensing cascade.

How does S. saprophyticus agrB compare structurally to the better-characterized S. aureus agrB?

While S. saprophyticus agrB has not been as extensively characterized as S. aureus agrB, comparative analysis suggests significant structural similarities. In S. aureus, AgrB contains several transmembrane alpha-helices and extracellular loops that are critical for its function. Research on S. aureus has identified that the first transmembrane alpha-helix and the extracellular loop 1 are decisive in the specific processing of group-specific AgrD . Given the conserved function of agrB across Staphylococcal species, S. saprophyticus AgrB likely shares similar structural features, though potentially with sequence variations that may confer species-specific interaction patterns with its cognate AgrD peptide.

How do researchers classify different variants of the agr system in Staphylococci?

Researchers classify agr systems based on sequence variations and specificity of the AIP-AgrC interaction. In S. aureus, four distinct groups (agrI, agrII, agrIII, and agrIV) have been identified based on variations in the agr sequences and group-specific interactions between the autoinducing peptide and AgrC receptor . Each agr variant produces its own specific AIP, which triggers autoinduction within its own group but can inhibit the response of other agr types, leading to heterologous mutual inhibition . This classification system is important for understanding strain-specific virulence patterns, as certain agr groups have been associated with specific disease manifestations. For example, many agrII S. aureus strains are isolated from acute infections, and approximately half of clinical methicillin-resistant S. aureus (MRSA) bloodstream isolates belong to the agrII group .

What is the mechanism by which AgrB processes AgrD into functional autoinducing peptides?

AgrB functions as a membrane-bound peptidase that processes the AgrD propeptide into a mature autoinducing peptide (AIP). This processing involves multiple steps, including the cleavage of the C-terminal portion of AgrD and the formation of a thiolactone ring structure that is essential for AIP activity. The interaction between AgrB and AgrD is group-specific, meaning that an AgrB variant preferentially processes its cognate AgrD . Research using chimeric AgrB proteins constructed by swapping domains between group I and group II S. aureus AgrB has revealed that specific structural elements determine this group specificity. For instance, in S. aureus, the first transmembrane alpha-helix and extracellular loop 1 of group I AgrB are crucial for processing group I AgrD, while two hydrophilic segments of group II AgrB are essential for processing group II AgrD . Interestingly, some chimeric AgrB constructs can process AgrD from multiple groups, suggesting a conserved underlying mechanism across different variants.

How does agrB interact with other components of the agr system to regulate virulence?

AgrB performs a specific function within the broader agr quorum sensing circuit. After AgrB processes AgrD into the active AIP, this signaling molecule is exported and accumulates in the extracellular environment. When AIP concentration reaches a threshold, it binds to the transmembrane receptor histidine kinase AgrC, which then phosphorylates the response regulator AgrA. Activated AgrA binds to the P2 and P3 promoters of the agr operon, leading to increased transcription of both the agr genes themselves (positive feedback) and RNAIII, the primary effector of the agr system . RNAIII then regulates the expression of numerous virulence genes, typically upregulating secreted toxins and enzymes while downregulating surface proteins. Through this cascade, AgrB indirectly contributes to the regulation of the entire virulence repertoire, making it a critical component for pathogenicity.

What role does agrB play in antibiotic resistance mechanisms in S. saprophyticus?

While agrB itself is not directly involved in antibiotic resistance, the agr system it supports can influence susceptibility to antimicrobials through several mechanisms. The agr system regulates biofilm formation, which can provide physical protection against antibiotics. Inhibition of the agr system has been shown to increase biofilm formation , potentially enhancing tolerance to antibiotics that struggle to penetrate biofilms. Additionally, the agr system's regulation of virulence factor expression may indirectly impact antibiotic effectiveness by altering bacterial metabolism, cell surface properties, and host-pathogen interactions. It's important to note that S. saprophyticus, like other staphylococci, can harbor mobile genetic elements carrying both metal resistance genes and antibiotic resistance determinants . While agrB itself may not confer resistance, the regulatory networks it participates in can influence how the bacterium responds to antibiotic challenges.

What are the most effective methods for cloning and expressing recombinant S. saprophyticus agrB?

For successful cloning and expression of recombinant S. saprophyticus agrB, researchers typically employ a multi-step approach. First, the agrB gene is amplified from S. saprophyticus genomic DNA using PCR with high-fidelity polymerase and primers designed with appropriate restriction sites. The amplified gene is then inserted into an expression vector, often containing an affinity tag (such as His-tag) for purification purposes . For expression, E. coli BL21(DE3) or similar strains are commonly used, with culture conditions optimized to address the challenges of expressing a transmembrane protein. Since AgrB is membrane-bound, it may require specialized expression systems that facilitate proper folding and membrane insertion. Induction conditions (temperature, IPTG concentration, duration) should be optimized to maximize soluble protein yield while minimizing toxicity and inclusion body formation. For purification, detergent-based methods are typically necessary to solubilize the membrane-bound AgrB. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are often used to maintain protein structure and function.

What assays can be used to evaluate the functional activity of recombinant agrB protein?

Several complementary assays can be employed to assess recombinant AgrB functionality:

  • AgrD Processing Assay: In vitro assays using purified AgrB and synthetic AgrD peptide substrates can measure the peptidase activity of AgrB. The processing of AgrD can be monitored using mass spectrometry or HPLC to detect the formation of AIP.

  • Complementation Assays: Introducing recombinant agrB into agrB-deficient strains to restore agr function. Successful complementation can be assessed by measuring:

    • Hemolytic activity on blood agar plates

    • Expression of agr-regulated proteins via SDS-PAGE of culture supernatants

    • Transcription levels of agr-regulated genes using qRT-PCR

    • Pigment production (staphyloxanthin) quantified spectrophotometrically (OD462)

  • Reporter Gene Assays: Using strains with reporter constructs (e.g., fluorescent proteins or luciferase) under the control of agr-regulated promoters (P2 or P3) to monitor activation of the agr system .

  • Biofilm Formation Assay: Since agr inhibition typically increases biofilm formation, crystal violet staining of biofilms can indirectly assess agrB function .

Table 1. Functional Assays for Recombinant AgrB Activity

Assay TypeMeasurement MethodExpected Result with Functional AgrBDetection Time
AgrD ProcessingMass Spectrometry/HPLCDetection of processed AIP1-2 hours
HemolysisBlood Agar PlatesClear zones around colonies24-48 hours
Protein ExpressionSDS-PAGE of supernatantAltered secreted protein profile24 hours
Reporter GeneFluorescence/LuminescenceIncreased signal from P2/P3 promoters2-12 hours
Biofilm FormationCrystal Violet StainingDecreased biofilm compared to agrB-null24-48 hours
qRT-PCRTranscript QuantificationIncreased RNAIII and virulence gene expression4-8 hours

How can researchers create chimeric agrB constructs to study domain-specific functions?

Creating chimeric AgrB constructs is a powerful approach for studying the structure-function relationship of specific domains. Researchers can follow these methodological steps:

  • Domain Mapping: First, identify the domains of interest in AgrB using predictive algorithms for transmembrane regions, conserved motifs, and secondary structure elements. For S. saprophyticus AgrB, this can be guided by the established domain architecture of S. aureus AgrB, which includes transmembrane alpha-helices and extracellular loops with known functional roles .

  • Chimera Design: Design chimeric constructs by swapping homologous domains between different AgrB variants. For example, exchanging domains between S. saprophyticus AgrB and S. aureus AgrB, or between different agr group variants. Careful design of junction points is critical to maintain proper protein folding.

  • Gene Synthesis/Assembly: Generate the chimeric gene constructs using overlap extension PCR, Gibson assembly, or direct gene synthesis. Each method requires careful primer design to ensure seamless junctions between domains.

  • Expression and Functional Testing: Express the chimeric constructs and test their functionality using the assays described in section 3.2. Compare the activity of chimeric proteins to wild-type controls to determine how specific domains contribute to function.

This approach has been successfully employed in S. aureus research, where chimeric AgrBs constructed by swapping between group I and group II variants revealed that specific segments are responsible for group-specific AgrD processing . Similar methods could elucidate the functional domains of S. saprophyticus AgrB.

What are the key differences in agrB function between S. saprophyticus and S. aureus?

While the fundamental function of AgrB is conserved across staphylococcal species, important differences exist between S. saprophyticus and S. aureus agrB. In S. aureus, the agr system has been classified into four distinct groups (agrI, agrII, agrIII, and agrIV) based on sequence variations and AIP specificity . Each group produces a unique AIP that activates its cognate receptor but inhibits receptors of other groups. The classification of agr variants in S. saprophyticus is less well-established, but genomic analyses suggest differences in agrB sequence and potentially in regulatory mechanisms.

One notable difference may be in the relationship between agr function and pathogenicity. While S. aureus is associated with a wide range of infections and its agr system regulates numerous virulence factors, S. saprophyticus is primarily a uropathogen . This more restricted tissue tropism suggests potential differences in the virulence genes regulated by the agr system. Additionally, S. saprophyticus possesses substantial resistance to heavy metals like copper and zinc , and it would be valuable to investigate whether the agr system interacts with these resistance mechanisms differently than in S. aureus.

How can evolutionary analysis of agrB sequences inform our understanding of species-specific adaptation?

Evolutionary analysis of agrB sequences across staphylococcal species can provide insights into how this quorum sensing component has adapted to different ecological niches. Phylogenetic analysis of agrB sequences from multiple staphylococcal species, including S. saprophyticus and S. aureus, can reveal evolutionary relationships and rates of sequence divergence. Areas of high conservation likely represent functionally critical domains, while regions of higher variability may indicate adaptation to species-specific requirements.

The variations in agrB may reflect adaptation to different host environments or competitive pressures. For instance, the agr system in S. aureus has been linked to specific disease associations, with particular agr groups being more prevalent in certain infection types . Similarly, sequence variations in S. saprophyticus agrB might reflect adaptation to the urinary tract environment where this species predominantly causes infection.

Horizontal gene transfer events can also be identified through evolutionary analysis, potentially revealing instances where agrB variants or domains have been exchanged between staphylococcal species. This could be particularly relevant for S. saprophyticus, as multiple metal resistance genes in this species have been found on mobile genetic elements , suggesting that portions of regulatory systems might similarly be subject to horizontal transfer.

What structural modeling approaches can predict functional domains in S. saprophyticus agrB based on S. aureus data?

Given the limited experimental data on S. saprophyticus AgrB structure, computational modeling approaches can leverage the more extensive knowledge of S. aureus AgrB to predict functional domains. These methodological approaches include:

  • Homology Modeling: Using the primary sequence of S. saprophyticus AgrB and the structural information available for S. aureus AgrB, homology modeling can generate predicted 3D structures. Software packages like MODELLER, SWISS-MODEL, or I-TASSER can be employed for this purpose.

  • Transmembrane Topology Prediction: Tools such as TMHMM, HMMTOP, or Phobius can predict the orientation and location of transmembrane segments in S. saprophyticus AgrB.

  • Conserved Domain Analysis: Databases like Pfam, SMART, or CDD can identify conserved domains within the S. saprophyticus AgrB sequence that may have known functions based on S. aureus or other species.

  • Molecular Dynamics Simulations: These can provide insights into protein flexibility, domain interactions, and potential binding sites for AgrD peptides.

The experimental work on S. aureus AgrB has shown that the first transmembrane alpha-helix and extracellular loop 1 are critical for group I AgrD processing, while two hydrophilic segments are crucial for group II AgrD processing . Structural modeling can predict whether similar domains in S. saprophyticus AgrB serve comparable functions, guiding targeted mutagenesis experiments to validate these predictions.

How might inhibitors of S. saprophyticus agrB be designed as potential anti-virulence therapeutics?

Designing inhibitors of S. saprophyticus AgrB represents a promising anti-virulence strategy that could attenuate pathogenicity without imposing strong selective pressure for resistance. Based on research with S. aureus agr inhibitors, several methodological approaches can be pursued:

  • Fragment-based Drug Discovery: Small drug-like fragments can be screened for binding to specific domains of AgrB. This approach has been successful with S. aureus, where fragments interacting with the DNA-binding domain of AgrA were identified and shown to reduce agr-driven transcription and toxin production .

  • Peptide Mimetics: Design of peptides that mimic the structure of AgrD but cannot be processed by AgrB, thereby competitively inhibiting the natural substrate.

  • Transmembrane Domain Disruptors: Compounds that interfere with the proper folding or membrane insertion of AgrB's transmembrane domains could prevent proper functioning.

  • Natural Product Screening: Many natural products have been found to inhibit quorum sensing in various bacteria and could be screened specifically against S. saprophyticus AgrB.

Potential inhibitors would need to be evaluated for their ability to reduce virulence factor expression without affecting bacterial growth, thus avoiding selection for resistance. Functional assays as described in section 3.2 would be valuable for assessing inhibitor efficacy. Additionally, since increased biofilm formation is a potential concern with agr inhibition , optimal inhibitors might need to be combined with biofilm-disrupting agents for maximal therapeutic benefit.

What is the relationship between heavy metal resistance mechanisms and agrB function in S. saprophyticus?

S. saprophyticus has been shown to possess high resistance to heavy metals, particularly copper and zinc, with MIC values reaching 1,600 mg/liter . This resistance is mediated by various metal efflux pumps and transporters, including copA, copB, copZ, mco, and csoR for copper, and zinT, czrAB, znuBC, and zur for zinc . An intriguing research question is whether and how these resistance mechanisms interact with the agrB-mediated quorum sensing system.

Several potential interactions merit investigation:

  • Co-regulation: Do agrB and metal resistance genes share regulatory elements or influence each other's expression? For instance, does activation of the agr system affect the expression of metal resistance genes or vice versa?

  • Functional Interaction: Given that AgrB is a membrane protein and many metal resistance determinants are also membrane-associated, do they functionally interact or influence each other's activity? For example, could metal stress affect AgrB processing of AgrD?

  • Evolutionary Linkage: Research has shown that resistance to arsenic and cadmium is linked to human infection and a clonal lineage of S. saprophyticus originating in animals . Is there a similar association between specific agrB variants and metal resistance profiles?

  • Mobile Genetic Elements: Many metal resistance genes in S. saprophyticus are carried on mobile genetic elements . Is there evidence for co-transfer of agrB variants or agr regulatory elements alongside metal resistance determinants?

Methodologically, these questions could be addressed through comparative genomics of clinical and environmental S. saprophyticus isolates, transcriptomic analysis under metal stress conditions, and phenotypic characterization of agrB mutants for metal resistance.

How do environmental conditions modulate agrB expression and function in S. saprophyticus?

The expression and function of AgrB, like many virulence regulators, is likely influenced by environmental conditions encountered during infection or colonization. For S. saprophyticus, which primarily causes urinary tract infections, understanding how urinary tract-specific conditions affect agrB is particularly relevant. Several methodological approaches can address this question:

  • Transcriptional Analysis: qRT-PCR or RNA-Seq to measure agrB expression under various conditions relevant to the urinary tract, including:

    • Urine pH variations (typically acidic)

    • Osmolarity changes

    • Nutrient limitation

    • Presence of host defense molecules

  • Protein Function Assays: Assess AgrB processing activity under different environmental conditions using the functional assays described in section 3.2.

  • Host-Pathogen Interaction Models: Evaluate agr system activity during interaction with host cells, such as bladder epithelial cells, using reporter constructs or transcriptomics.

  • In vivo Expression Studies: Use animal models of urinary tract infection to monitor agrB expression and function during actual infection.

Research with S. aureus has shown that environmental factors like pH, osmolarity, and specific host molecules can significantly impact agr function. For instance, studies have demonstrated that S. aureus can hyperosmoregulate in acidified conditions, a capability that may be linked to certain agr-regulated genes . Similar adaptations may exist in S. saprophyticus, particularly given its niche as a uropathogen exposed to the variable and often challenging conditions of the urinary tract.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.