Recombinant Staphylococcus saprophyticus subsp. saprophyticus Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus saprophyticus subsp. saprophyticus Antiholin-like Protein LrgB (lrgB)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Antiholin-like protein LrgB (lrgB) is a genetically engineered protein produced in Escherichia coli for research applications. This 233-amino acid protein (UniProt ID: Q4A012) is part of the lrgAB operon, which regulates bacterial cell lysis and biofilm formation by modulating autolytic activity . Its recombinant form includes an N-terminal His tag for purification and detection purposes .

Protein Characteristics

PropertyDescription
SpeciesStaphylococcus saprophyticus subsp. saprophyticus
Expression SystemE. coli
TagN-terminal His tag
Amino Acid SequenceMIEHLAINTPYFGILLSLIPFIIATFLFKKTNGFFLFTPLFVSMVVGIAFLKLTGIDYANYKIGGDIINFFLEPATICFAIPLYKRRDVLKKYWKQILGGITLGTTAALVCIYLIAEAFQFSNGIIASMLPQGATTAIALPVSADIGGIKELTSLAVILNGVIIYALGSKLIKLFNITNPIARGLALGTSGHSLGVSSAQEFGETEASMASISLVIVGVIVVIVAPILATLLL
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstitute in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Domains

  • Antiholin-like activity: LrgB forms a complex with LrgA to inhibit holin-mediated cell lysis, analogous to phage antiholins .

  • Membrane association: Predicted transmembrane domains enable interaction with the cytoplasmic membrane .

Regulation of Cell Lysis and Biofilm Formation

  • Autolysis suppression: LrgB represses murein hydrolase activity, reducing extracellular DNA (eDNA) release and biofilm accumulation . Inactivation of lrgB increases autolysis by 4-fold (p < 0.0001) and enhances biofilm adherence via eDNA-dependent mechanisms .

  • Biofilm modulation: Overexpression of lrgB decreases biofilm formation by 55–70% in S. aureus, while knockout mutants exhibit hyper-biofilm phenotypes .

Metabolic Transport

  • Pyruvate utilization: LrgAB facilitates pyruvate uptake under anaerobic conditions, critical for energy metabolism in S. aureus .

Comparative Analysis of Wild-Type vs. Recombinant LrgB

FeatureWild-Type LrgBRecombinant LrgB
ExpressionNative operon-dependentConstitutive expression in E. coli
FunctionAutolysis regulation in biofilmsTool for studying holin-antiholin dynamics
PurificationLow yield in native hostsHigh purity (>90%) via His-tag affinity

Experimental Insights

  • Genetic inactivation: Deletion of lrgB in S. aureus increases virulence in catheter-associated infections (p < 0.01) .

  • Transcriptional regulation: lrgB expression is 5-fold lower in biofilm-associated cells compared to planktonic cells, promoting eDNA release .

Clinical and Industrial Relevance

  • Antibiotic tolerance: Biofilms enriched with eDNA due to lrgB inactivation show resistance to β-lactams and vancomycin .

  • Biotechnological potential: Recombinant LrgB is used to probe mechanisms of bacterial programmed cell death and metabolic transport .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
lrgB; SSP0461; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
lrgB
Target Protein Sequence
MIEHLAINTPYFGILLSLIPFIIATFLFKKTNGFFLFTPLFVSMVVGIAFLKLTGIDYAN YKIGGDIINFFLEPATICFAIPLYKRRDVLKKYWKQILGGITLGTTAALVCIYLIAEAFQ FSNGIIASMLPQGATTAIALPVSADIGGIKELTSLAVILNGVIIYALGSKLIKLFNITNP IARGLALGTSGHSLGVSSAQEFGETEASMASISLVIVGVIVVIVAPILATLLL
Uniprot No.

Target Background

Function
This protein inhibits the expression or activity of extracellular murein hydrolases by interacting, potentially with LrgA, with the holin-like proteins CidA and/or CidB. The LrgAB and CidAB proteins may influence the proton motive force of the membrane. It could be involved in programmed cell death (PCD), possibly triggering PCD in response to antibiotics and environmental stresses.
Database Links

KEGG: ssp:SSP0461

STRING: 342451.SSP0461

Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the LrgB protein in Staphylococcus saprophyticus and what is its functional significance?

The LrgB protein in Staphylococcus saprophyticus is classified as an antiholin-like protein encoded by the lrgB gene (locus name: SSP0461). This membrane-associated protein is part of a regulatory system involved in controlling cell wall hydrolysis and autolysis processes. Functionally similar to its homolog in S. aureus, the LrgB protein is hypothesized to modulate murein hydrolase activity, which affects bacterial cell wall integrity and turnover .

The protein is particularly significant in understanding bacterial cell death and lysis mechanisms, which has implications for biofilm formation and antibiotic resistance. The LrgB protein is part of a larger regulatory network that helps bacteria respond to environmental stresses, making it an important target for research into bacterial survival mechanisms .

How is the lrgB gene regulated in Staphylococcus saprophyticus?

In Staphylococcus species, the lrgB gene typically forms part of an operon structure. Based on research in related staphylococcal species, the lrgB gene is likely regulated by the LytSR two-component regulatory system. This system responds to changes in membrane potential and other environmental signals to modulate expression of the lrgAB operon .

The regulation mechanism involves:

  • Detection of environmental signals by the LytS sensor kinase

  • Phosphorylation and activation of the LytR response regulator

  • Binding of LytR to the promoter region of the lrgAB operon

  • Modulation of lrgAB transcription

This regulatory system allows the bacterium to fine-tune its autolytic activity and cell wall metabolism in response to changing environmental conditions, which is critical for survival under stress conditions and during biofilm formation .

What is the relationship between LrgB and biofilm formation in Staphylococcus saprophyticus?

The relationship between LrgB and biofilm formation in S. saprophyticus is complex. Research indicates that biofilm production in S. saprophyticus is primarily ica-independent, distinguishing it from some other staphylococcal species. Only a minority of S. saprophyticus strains carry a complete ica gene cluster (icaADBCR), which is typically associated with biofilm formation in other staphylococci .

The role of LrgB in biofilm formation appears to involve:

  • Regulation of cell lysis, which releases DNA and other cellular components that form part of the biofilm matrix

  • Modulation of cell wall turnover, affecting bacterial adhesion properties

  • Potential interaction with other regulatory systems that control the transition between planktonic and biofilm growth

Notably, the composition of S. saprophyticus biofilms differs between environmental and clinical isolates, suggesting that the modulation of biofilm structure, potentially involving LrgB activity, may be a key factor in the pathogenicity of these bacteria .

How should experimental designs address the hierarchical nature of data when studying LrgB function in different bacterial populations?

When studying LrgB function across different bacterial populations, researchers must implement hierarchical experimental designs that properly account for nested data structures. This is critical because measurements from the same bacterial culture or colony are not statistically independent observations.

A proper experimental design should:

  • Clearly identify the hierarchy levels (e.g., strains → biological replicates → technical replicates)

  • Ensure appropriate randomization at each level where treatments are applied

  • Include sufficient replicates at each hierarchical level to achieve adequate statistical power

For data analysis, conventional statistical approaches like t-tests or ANOVA may lead to pseudoreplication if they fail to account for the hierarchical structure. Instead, researchers should consider:

  • Using resampling-based hypothesis tests like those implemented in the Python package Hierarch, which explicitly model the nested structure of the data

  • Applying mixed-effects models that can properly partition variance components at different hierarchical levels

  • Performing permutation tests at the level where treatments were administered

What are the recommended approaches for mixed methods analysis when studying both structural and functional aspects of LrgB?

To comprehensively study both structural and functional aspects of LrgB, researchers should employ mixed methods approaches that integrate quantitative and qualitative data. The research questions should explicitly embed both quantitative and qualitative components to guide the analysis process.

Recommended analysis framework:

  • Data transformation stage: Convert qualitative observations about protein structure into quantitative metrics that can be compared with functional assays.

  • Data correlation stage: Examine relationships between structural features and functional outcomes using appropriate correlation analyses.

  • Data comparison stage: Compare different strains or mutants using both structural and functional metrics.

  • Data integration stage: Develop an integrated model that explains how structural variations in LrgB relate to functional differences.

  • Data reduction stage: Identify the key structural determinants that most strongly predict functional outcomes.

  • Data consolidation stage: Create a unified interpretation that accounts for both structural and functional data.

  • Data validation stage: Test the model predictions using independent experimental approaches .

This mixed methods approach allows researchers to address complex questions about structure-function relationships that neither purely quantitative nor purely qualitative approaches could adequately address alone .

How can comparative genomic approaches be used to study the evolution and acquisition of LrgB in Staphylococcus saprophyticus?

Comparative genomic approaches provide powerful tools for investigating the evolutionary history and acquisition of LrgB in S. saprophyticus. Research indicates that S. saprophyticus has likely acquired various genetic elements from other coagulase-negative staphylococci through horizontal gene transfer .

Methodological approach:

  • Whole genome sequencing of diverse S. saprophyticus isolates from both clinical and environmental sources.

  • Pan-genome analysis to identify the core and accessory genome components, with special focus on the lrgAB operon and associated regulatory elements.

  • Phylogenetic analysis of the lrgB gene across staphylococcal species to establish evolutionary relationships and potential horizontal gene transfer events.

  • Pan-GWAS (Genome-Wide Association Studies) to identify genetic variants associated with particular phenotypes or ecological niches.

  • Synteny analysis of the genomic regions surrounding lrgB to identify evidence of genomic islands or other mobile genetic elements.

  • Comparative analysis of regulatory regions to understand how expression patterns may have evolved across different lineages.

The implementation of this approach has revealed that elements like the complete icaADBCR cluster (related to biofilm formation) have been acquired multiple times by S. saprophyticus from other coagulase-negative staphylococci. Similar analyses could provide insights into the acquisition and evolution of the lrgB gene and its regulatory elements .

What analytical methods should be used to characterize the membrane topology and protein-protein interactions of LrgB?

Characterizing the membrane topology and protein-protein interactions of LrgB requires a combination of experimental and computational approaches. The following analytical methods are recommended:

Membrane topology analysis:

  • Hydropathy plot analysis using algorithms such as Kyte-Doolittle or TMHMM to predict transmembrane regions based on the amino acid sequence.

  • Cysteine scanning mutagenesis combined with accessibility assays to experimentally map membrane-spanning regions.

  • PhoA/LacZ fusion analysis to determine which portions of the protein are exposed to the periplasm versus the cytoplasm.

  • Cryo-electron microscopy to visualize the protein structure within the membrane environment.

Protein-protein interaction analysis:

  • Bacterial two-hybrid assays to identify potential interaction partners, particularly focusing on interactions with LrgA and components of the cell wall synthesis machinery.

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners in vivo.

  • Crosslinking studies to capture transient interactions that may occur during dynamic processes like cell division or stress response.

  • FRET (Förster Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) assays to study interactions in living cells.

These methods should be applied in an iterative manner, with computational predictions guiding experimental design and experimental results refining computational models .

What are the optimal conditions for expressing and purifying recombinant Staphylococcus saprophyticus LrgB protein?

The optimal conditions for expressing and purifying recombinant S. saprophyticus LrgB protein must address the challenges associated with membrane proteins while maximizing yield and activity.

Expression system recommendations:

  • Expression vector: Use vectors with tunable promoters (like pET systems) that allow precise control of expression levels to prevent toxicity associated with membrane protein overexpression.

  • Host strain: E. coli strains C41(DE3) or C43(DE3), which are specifically designed for membrane protein expression, or BL21(DE3) pLysS for tighter expression control.

  • Expression conditions:

    • Growth temperature: 20-25°C after induction (lower temperatures reduce inclusion body formation)

    • Induction: 0.1-0.5 mM IPTG for pET systems

    • Media supplementation: 0.5-1% glucose to suppress basal expression before induction

Purification protocol:

  • Membrane fraction isolation:

    • Cell lysis by sonication or pressure-based methods in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Differential centrifugation to isolate membrane fractions (low-speed centrifugation to remove debris, high-speed centrifugation to collect membranes)

  • Solubilization:

    • Detergent screening is essential (try n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin)

    • Typical conditions: 1% detergent, 1 hour at 4°C with gentle agitation

  • Affinity purification:

    • If tagged, use appropriate affinity resin (Ni-NTA for His-tagged proteins)

    • Include 0.05-0.1% detergent in all buffers to maintain solubility

  • Storage:

    • Store in Tris-based buffer with 50% glycerol at -20°C for extended storage

This protocol can be optimized based on specific research requirements and the intended downstream applications of the purified protein.

How should researchers design experiments to study the role of LrgB in bacterial cell death and lysis?

Designing experiments to study LrgB's role in bacterial cell death and lysis requires a multifaceted approach that combines genetic manipulation, physiological measurements, and microscopy techniques.

Experimental design framework:

  • Genetic manipulation strategies:

    • Generate lrgB knockout mutants using allelic replacement techniques

    • Create conditional expression strains where lrgB expression can be controlled

    • Develop fluorescently tagged LrgB constructs for localization studies

  • Phenotypic characterization:

    • Growth curves under different stress conditions (oxidative stress, nutrient limitation, antibiotic challenge)

    • Autolysis assays using Triton X-100 or other autolysis-inducing agents

    • Peptidoglycan hydrolase activity measurements using zymography

  • Microscopy approaches:

    • Time-lapse microscopy to monitor cell division and lysis events

    • Fluorescent membrane potential indicators to assess membrane integrity

    • Electron microscopy to evaluate cell wall structure in wild-type versus mutant strains

  • Molecular analysis:

    • Transcriptomic analysis to identify genes differentially expressed in lrgB mutants

    • Chromatin immunoprecipitation (ChIP) to identify regulatory interactions

    • Membrane proteomics to identify changes in the membrane protein composition

  • Statistical analysis considerations:

    • Account for hierarchical data structure when analyzing results from different bacterial populations

    • Use appropriate resampling-based hypothesis tests for nested experimental designs

This comprehensive approach ensures that the complex role of LrgB in bacterial cell death and lysis can be effectively characterized across different physiological conditions and genetic backgrounds.

What methodological approaches should be used to investigate the interaction between LrgB and the bacterial cell wall hydrolysis machinery?

Investigating the interaction between LrgB and the bacterial cell wall hydrolysis machinery requires specialized techniques that can detect and characterize protein-protein interactions in the context of the bacterial cell membrane and cell wall environment.

Recommended methodological approaches:

  • In vitro peptidoglycan hydrolysis assays:

    • Prepare purified cell walls labeled with fluorescent compounds

    • Measure hydrolysis rates in the presence and absence of purified LrgB protein

    • Assess the effect of LrgB on the activity of specific purified hydrolases

  • Localization studies:

    • Super-resolution microscopy (STORM, PALM) of fluorescently-tagged LrgB and cell wall hydrolases

    • Co-localization analysis to identify spatial and temporal patterns

    • Correlative light and electron microscopy to link protein localization with cell wall ultrastructure

  • Protein-protein interaction techniques:

    • Bacterial two-hybrid screening focusing on known cell wall hydrolases

    • Split-GFP complementation assays to verify interactions in vivo

    • Chemical crosslinking followed by mass spectrometry (XL-MS) to map interaction interfaces

  • Functional assays:

    • Site-directed mutagenesis of key LrgB residues followed by phenotypic analysis

    • Suppressor mutation analysis to identify genetic interactions

    • Peptidoglycan composition analysis using HPLC in wild-type and lrgB mutant strains

  • Biophysical approaches:

    • Surface plasmon resonance (SPR) to measure binding kinetics between LrgB and putative interaction partners

    • Isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamics

    • Native mass spectrometry of membrane protein complexes

How should researchers analyze hierarchical data when comparing LrgB function across different Staphylococcus saprophyticus strains?

Recommended data analysis approach:

  • Define hierarchical levels clearly:

    • Level 1: Strains (different S. saprophyticus isolates)

    • Level 2: Biological replicates (independent cultures of each strain)

    • Level 3: Technical replicates (multiple measurements from each culture)

  • Apply appropriate statistical methods:

    • Hierarchical linear models (HLM) or mixed-effects models that account for random effects at each level

    • Resampling-based hypothesis tests like those implemented in the Python package Hierarch

    • Nested ANOVA designs that properly partition variance components

  • Avoid common analytical errors:

    • Do not treat technical replicates as independent samples

    • Do not aggregate data without accounting for variance at intermediate levels

    • Do not apply simple t-tests or ANOVA without considering the nested structure

What are the key considerations when interpreting comparative genomic data related to LrgB evolution in staphylococcal species?

Interpreting comparative genomic data related to LrgB evolution requires careful consideration of several factors to avoid misinterpretations and establish reliable evolutionary relationships.

Key considerations for interpretation:

Evidence from Staphylococcus saprophyticus research has shown that some genetic elements (like the complete icaADBCR cluster) were acquired multiple times through horizontal gene transfer from other coagulase-negative staphylococci. Similar patterns may be observed with lrgB, requiring careful analysis to distinguish between vertical inheritance and horizontal acquisition .

How can researchers integrate structural, functional, and evolutionary data to develop comprehensive models of LrgB activity?

Integrating structural, functional, and evolutionary data to develop comprehensive models of LrgB activity requires a multidisciplinary approach that synthesizes diverse data types into a cohesive framework.

Integration framework:

  • Data collection from multiple sources:

    • Structural data: protein structures, membrane topology, interaction interfaces

    • Functional data: phenotypic effects of mutations, activity assays, localization patterns

    • Evolutionary data: sequence conservation, selection patterns, phylogenetic relationships

  • Data normalization and transformation:

    • Convert qualitative observations to quantitative metrics where possible

    • Standardize scales across different data types

    • Apply dimension reduction techniques to identify key variables

  • Integration methods:

    • Network-based approaches: Construct interaction networks that incorporate protein-protein interactions, genetic interactions, and evolutionary relationships

    • Bayesian integration frameworks: Use Bayesian methods to combine evidence from multiple sources with appropriate uncertainty quantification

    • Machine learning approaches: Apply supervised or unsupervised learning to identify patterns across data types

  • Model development and refinement:

    • Develop initial models based on strongest supported hypotheses

    • Iteratively refine models by testing predictions against new experimental data

    • Incorporate feedback loops between computational predictions and experimental validation

  • Validation strategies:

    • Cross-validation using held-out data

    • Independent experimental validation of key model predictions

    • Consistency checking across different data types and analysis methods

This integrated approach allows researchers to develop models that explain how structural features of LrgB relate to its functional roles in cell wall metabolism and how these features have evolved across different staphylococcal species and strains .

What statistical approaches are most appropriate for analyzing the effects of LrgB mutations on bacterial phenotypes?

When analyzing the effects of LrgB mutations on bacterial phenotypes, researchers should employ statistical approaches that can handle complex phenotypic data while accounting for experimental design factors and potential confounding variables.

Recommended statistical approaches:

  • For continuous phenotypic measurements (e.g., growth rates, autolysis rates):

    • Linear mixed-effects models to account for random effects from batches and technical replicates

    • Hierarchical Bayesian models for improved uncertainty quantification

    • Longitudinal data analysis for time-series measurements with repeated sampling

  • For categorical or binary phenotypes (e.g., survival, biofilm formation):

    • Generalized linear mixed models (GLMMs) with appropriate link functions

    • Survival analysis for time-to-event data

    • Bayesian hierarchical logistic regression for binary outcomes

  • For high-dimensional phenotypic data (e.g., -omics data):

    • Multivariate analysis techniques like principal component analysis (PCA) or partial least squares (PLS)

    • Regularized regression methods (LASSO, Ridge, Elastic Net) for feature selection

    • Random forest or other machine learning approaches for complex phenotypic patterns

  • Experimental design considerations:

    • Proper randomization and blocking to control for batch effects

    • Sample size determination based on power analysis

    • Inclusion of appropriate controls (wild-type, complemented mutants)

These approaches ensure robust statistical inference while properly accounting for the hierarchical nature of experimental designs in microbiology research .

How can understanding LrgB function contribute to developing new antimicrobial strategies?

Understanding LrgB function in Staphylococcus saprophyticus and other staphylococcal species provides several potential avenues for developing novel antimicrobial strategies that target bacterial cell death and lysis mechanisms.

Potential antimicrobial approaches based on LrgB research:

  • Disruption of cell death regulation:

    • Compounds that inhibit LrgB function could potentially increase susceptibility to autolysis

    • Small molecules that mimic LrgB interaction partners might dysregulate cell wall metabolism

    • Peptides derived from LrgB interaction interfaces could block critical protein-protein interactions

  • Biofilm disruption strategies:

    • Since LrgB is implicated in biofilm formation processes, targeting its function could disrupt established biofilms

    • Combination therapies that target both LrgB function and conventional antibiotics could enhance efficacy against biofilm-associated infections

    • Modulators of LrgB expression could potentially prevent biofilm formation during early infection stages

  • Strain-specific targeting:

    • Comparative genomic approaches have revealed variation in LrgB across different strains

    • These differences could be exploited to develop narrow-spectrum antimicrobials that target specific pathogenic strains

    • Such targeted approaches could help preserve beneficial microbiota

  • Potentiation of existing antibiotics:

    • Inhibitors of LrgB could potentially sensitize resistant strains to cell wall-active antibiotics

    • Combination therapy approaches could reduce the effective dose of conventional antibiotics

    • This strategy might help extend the useful lifetime of existing antimicrobial agents

The development of these strategies requires detailed understanding of LrgB structure, function, and its role in bacterial physiology under different environmental conditions. Such approaches represent promising directions for addressing the growing challenge of antimicrobial resistance .

What experimental systems are most appropriate for studying LrgB function in the context of urinary tract infections?

Studying LrgB function in the context of urinary tract infections (UTIs) requires experimental systems that can recapitulate key aspects of the host-pathogen interaction in the urinary tract environment.

Recommended experimental systems:

  • In vitro models:

    • Artificial urine medium (AUM) to simulate the chemical environment of the urinary tract

    • pH and osmolarity gradients to mimic conditions from bladder to kidney

    • Flow cell systems to incorporate shear stress similar to urinary flow

    • Co-culture systems with bladder epithelial cells and S. saprophyticus

  • Cell culture models:

    • Human bladder epithelial cell lines (e.g., 5637, T24) for adhesion and invasion assays

    • 3D organoid cultures derived from human bladder tissue for more physiologically relevant interactions

    • Transwells with polarized uroepithelial cells to study bacterial translocation

  • Ex vivo models:

    • Isolated bladder tissue in organ culture to study bacterial colonization

    • Perfused kidney models to assess ascending infection dynamics

  • In vivo models:

    • Murine UTI models with transurethral inoculation

    • Neutropenic mouse models for studying severe infections

    • Humanized mouse models with human bladder tissue grafts

  • Comparative experimental design considerations:

    Experimental SystemAdvantagesLimitationsBest Applications
    Artificial urine mediumControlled environment, high throughputLacks host factorsInitial screening of mutants
    Cell culture modelsIncorporates host cell interactionsSimplified systemCellular response studies
    Ex vivo modelsPreserves tissue architectureShort experimental durationColonization mechanisms
    Mouse modelsFull host responseSpecies differencesIn vivo pathogenesis
  • Data collection parameters:

    • Bacterial burden in urine and tissues

    • Biofilm formation on catheters or epithelial surfaces

    • Host inflammatory responses

    • Gene expression changes in bacteria and host

    • Bacterial survival under antibiotic challenge

These systems should be employed in a complementary manner, with simpler systems used for initial characterization and more complex models for validation of key findings. This hierarchical approach ensures both mechanistic understanding and physiological relevance .

How might comparative analysis of LrgB across different staphylococcal species inform our understanding of species-specific pathogenicity?

Comparative analysis of LrgB across different staphylococcal species provides valuable insights into how this protein may contribute to species-specific pathogenicity and adaptation to different ecological niches.

Methodological approach for comparative analysis:

  • Sequence-based comparisons:

    • Multiple sequence alignment of LrgB proteins across staphylococcal species

    • Identification of conserved domains versus variable regions

    • Analysis of selection pressure using dN/dS ratios to detect positively selected sites

  • Structural comparisons:

    • Homology modeling of LrgB from different species

    • Comparison of predicted membrane topology and protein folding

    • Analysis of structural features that might affect function

  • Genomic context analysis:

    • Comparison of the lrgAB operon organization across species

    • Analysis of regulatory elements and potential transcription factor binding sites

    • Investigation of co-occurring genes that might form functional networks

  • Functional comparisons:

    • Heterologous expression studies to test functional complementation

    • Chimeric protein construction to identify domains responsible for species-specific functions

    • Comparative phenotypic analysis of deletion mutants in different species

  • Correlation with pathogenicity:

    • Mapping of LrgB sequence/structural features to known virulence characteristics

    • Analysis of LrgB variants in clinical versus environmental isolates

    • Investigation of LrgB expression patterns during infection models

Key insights from comparative analysis:

Research has shown that biofilm composition differs significantly between environmental and clinical isolates of S. saprophyticus, suggesting that the modulation of biofilm structure could be a key step in pathogenicity. Additionally, comparative genomic analysis has revealed that some genetic elements have been acquired multiple times through horizontal gene transfer from other coagulase-negative staphylococci, contributing to the diverse virulence characteristics observed across staphylococcal species .

This comparative approach can reveal how variations in LrgB structure and function contribute to the distinct pathogenic strategies employed by different staphylococcal species, potentially identifying species-specific targets for antimicrobial development.

What are the most promising future research directions for studying LrgB in Staphylococcus saprophyticus?

Based on current knowledge and technological capabilities, several promising research directions emerge for studying LrgB in Staphylococcus saprophyticus that could significantly advance our understanding of this protein's role in bacterial physiology and pathogenesis.

Future research priorities:

  • Structural biology approaches:

    • Determination of high-resolution structures of LrgB using cryo-electron microscopy or X-ray crystallography

    • Investigation of conformational changes during function using techniques like hydrogen-deuterium exchange mass spectrometry

    • Elucidation of the complete membrane topology and identification of critical functional domains

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics to understand the broader regulatory networks involving LrgB

    • Network analysis to identify key interaction partners and regulatory relationships

    • Machine learning approaches to predict phenotypic outcomes from genetic variations

  • Host-pathogen interaction studies:

    • Investigation of how LrgB function affects persistence during urinary tract infections

    • Examination of host immune recognition of LrgB or its downstream effects

    • Development of more physiologically relevant infection models to study LrgB in vivo

  • Translational applications:

    • Design of small molecule inhibitors targeting LrgB function based on structural information

    • Development of diagnostic approaches based on LrgB expression or activity

    • Investigation of LrgB as a potential vaccine candidate or therapeutic target

  • Evolutionary and ecological studies:

    • Broader sampling of S. saprophyticus strains from diverse sources to understand ecological adaptation

    • Investigation of the selective pressures driving LrgB evolution in different environments

    • Comparative analysis across more distantly related bacterial species with LrgB homologs

These research directions should be pursued using interdisciplinary approaches that combine molecular microbiology, structural biology, genomics, bioinformatics, and infection biology to develop a comprehensive understanding of LrgB function and its role in staphylococcal biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.