Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant atpB protein is produced via heterologous expression in E. coli, followed by affinity chromatography using the His tag . Lyophilized powder formulations ensure stability, with recommendations against repeated freeze-thaw cycles to maintain functional integrity .

Functional Significance

ATP synthase subunit a is integral to the F<sub>0</sub> sector, facilitating proton translocation across the membrane to drive ATP synthesis in the F<sub>1</sub> domain . Key functional roles include:

  • Biofilm persistence: In Staphylococcus aureus, ATP synthase mutants (e.g., ΔatpA) exhibit altered biofilm dynamics, leading to heightened proinflammatory cytokine responses (e.g., IL-6, TNF-α) and improved clearance in murine infection models .

  • Antibiotic susceptibility: Inhibition of ATP synthase (e.g., by oligomycin A) sensitizes S. aureus to polymyxins, suggesting a role in intrinsic antibiotic resistance .

Role in Bacterial Metabolism and Pathogenesis

  • Membrane potential regulation: S. aureus ΔatpA mutants display hyperpolarized membranes, impairing proton motive force and energy metabolism .

  • Host immune modulation: ATP synthase deficiency in S. aureus biofilms increases leukocyte survival by reducing toxin production, enhancing immune-mediated clearance .

Clinical and Therapeutic Implications

  • Biofilm-associated infections: ATP synthase contributes to biofilm resilience in S. saprophyticus, a common uropathogen . Targeting this enzyme could disrupt biofilm-mediated antibiotic resistance.

  • Antibiotic adjuvants: ATP synthase inhibitors (e.g., oligomycin A) enhance polymyxin efficacy against Gram-positive pathogens , offering a combinatorial therapeutic strategy.

Comparative Analysis of ATP Synthase Studies

StudyKey FindingRelevance to atpB
S. aureus ΔatpA Biofilm clearance via immune activationHighlights subunit a's role in immune evasion
Polymyxin susceptibility ATP synthase inhibition sensitizes to polymyxinsDirect link to membrane potential regulation
Tomatidine resistance atpE mutations reduce ATP synthesisSupports ATP synthase as a drug target

Future Directions

  • Mechanistic studies: Elucidate proton channeling mechanisms in S. saprophyticus ATP synthase.

  • Therapeutic development: Screen ATP synthase inhibitors for anti-biofilm activity in urinary tract infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please specify it, and we will prioritize its inclusion during development.
Synonyms
atpB; SSP0775; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
atpB
Target Protein Sequence
MNHKDPLVSWNVFGLDVVFNLSSIMMLIITAVIVFVIAIICTRNLKKRPTGKQNFIEWVF DFVRGIIESNMAWSKGGQFHFLAVTLIFFIFVSNMLGLPFQLISGHTLWWKSPTADATVT LTLSTLIILLTHFYGVRMKGTKGYFQNYTKPIFLLPINIFEEFTSTLTLGLRLYGNIFAG ELLLGLLAGLVTGDSTRAWGWIIGLPGLVVWQGFSIFIGTIQAYIFVMLSMVYMSHKVQD SH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: ssp:SSP0775

STRING: 342451.SSP0775

Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus saprophyticus ATP synthase subunit a (atpB)?

The ATP synthase subunit a (atpB) in S. saprophyticus is a membrane protein component of the F0 sector of ATP synthase, consisting of 242 amino acids. This protein plays a critical role in maintaining the proton gradient across the bacterial membrane and is essential for ATP synthesis. The recombinant form typically includes a His-tag for purification purposes and can be expressed in E. coli expression systems for research applications . Structurally, atpB contains multiple transmembrane domains that form a proton channel within the ATP synthase complex.

How is recombinant S. saprophyticus atpB protein typically expressed and purified?

Methodology for expression and purification of recombinant atpB:

  • Vector selection: Use of pET-based expression vectors with N-terminal His-tag

  • Expression system: Transformation into E. coli expression strains (typically BL21(DE3))

  • Induction conditions:

    • IPTG concentration: 0.5-1.0 mM

    • Temperature: 18-25°C (reduced temperature improves solubility)

    • Duration: 4-16 hours

  • Cell lysis:

    • Mechanical disruption (sonication or French press)

    • Buffer composition: Tris/PBS-based buffer with detergents (e.g., n-dodecyl β-D-maltoside)

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Optional secondary purification: Size exclusion chromatography

  • Final preparation: Lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

What are the optimal storage conditions for recombinant atpB protein?

For long-term stability of recombinant S. saprophyticus atpB:

  • Primary storage: Store lyophilized protein at -20°C to -80°C

  • Working aliquots: Store at 4°C for up to one week

  • Reconstituted protein: Add glycerol (final concentration 5-50%) and aliquot for long-term storage at -20°C/-80°C

  • Stability considerations: Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity

  • Buffer recommendations: Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides optimal stability

How should recombinant atpB be reconstituted for experimental use?

Detailed reconstitution protocol:

  • Initial preparation: Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitution medium: Add deionized sterile water to achieve concentration of 0.1-1.0 mg/mL

  • Solubilization: Gently pipette to dissolve completely, avoid vigorous shaking

  • Glycerol addition: For long-term storage, add glycerol to a final concentration of 5-50%

  • Aliquoting: Divide into single-use aliquots before freezing

  • Quality control: Verify protein concentration using Bradford assay or BCA method

  • Activity verification: Test ATP hydrolysis activity using a coupled enzyme assay

What functional assays can be used to verify the activity of recombinant atpB?

Several complementary approaches can be employed:

  • ATP hydrolysis assays:

    • Coupled enzyme assay using ATP, pyruvate kinase, and lactate dehydrogenase

    • Measurement of inorganic phosphate release using malachite green

  • Reconstitution in liposomes:

    • Preparation of proteoliposomes containing purified ATP synthase components

    • Measurement of ATP synthesis driven by artificial proton gradients

  • Proton translocation assays:

    • Use of pH-sensitive fluorescent dyes (e.g., ACMA)

    • Monitoring fluorescence changes in response to ATP hydrolysis

Assay TypeSensitivityAdvantagesLimitations
Coupled enzymeHighReal-time monitoringPotential interference from coupling enzymes
Malachite greenModerateSimple, endpoint measurementNot suitable for real-time kinetics
ProteoliposomeVariablePhysiologically relevantComplex preparation, technical challenges
Proton translocationHighDirect measurement of functionRequires specialized equipment

What role does ATP synthase play in biofilm formation in Staphylococcus species?

Research on S. aureus ATP synthase provides insights that may be relevant to understanding S. saprophyticus atpB function:

  • Biofilm persistence: ATP synthase mutants (particularly ΔatpA) in S. aureus show altered biofilm formation capabilities. This suggests a critical role for ATP synthase beyond energy production

  • Immune modulation: S. aureus ATP synthase influences host immune responses during biofilm-associated infections:

    • ΔatpA mutants elicit heightened proinflammatory cytokine production by leukocytes

    • This leads to improved biofilm clearance in infection models

    • The effect is cell lysis-dependent, as inhibition of bacterial lysis prevents cytokine production

  • Metabolic adaptation: ATP synthase enables metabolic flexibility during biofilm formation, allowing bacteria to adjust to low-oxygen environments and nutrient limitation

  • Potential mechanisms: ATP synthase may influence biofilm formation through:

    • Maintenance of intracellular pH homeostasis

    • Regulation of energy-dependent processes essential for biofilm matrix production

    • Modulation of toxin and protease production

These findings suggest that targeting ATP synthase could be a strategy for biofilm control in staphylococcal infections.

How can mutations in atpB affect bacterial physiology and virulence?

Studies on ATP synthase mutations in staphylococcal species reveal:

  • Energy metabolism: Mutations in atpB disrupt proton translocation, compromising ATP synthesis and affecting all energy-dependent processes

  • Virulence factor expression: In S. aureus, ATP synthase mutants show:

    • Decreased toxin and protease production (as determined by LC-MS/MS)

    • Altered leukocyte survival during interactions with biofilms

  • Intracellular acidification: Mutations in ATP synthase genes (like atpG in S. aureus) impair intracellular acidification, which is required for optimal activity of fermentative enzymes that generate energy when respiration is compromised

  • Biofilm clearance: ATP synthase alpha subunit mutant (ΔatpA) biofilms in S. aureus elicit enhanced inflammatory responses, resulting in improved biofilm clearance in infection models

MutationObserved EffectImplication for Virulence
ΔatpA (alpha subunit)Increased proinflammatory cytokine productionReduced biofilm persistence
atpG mutationFailure in intracellular acidificationReduced virulence in skin/soft tissue infection
Walker B motif mutation (E145Q)Loss of ATPase activityImpaired peptide toxin secretion

These findings suggest that atpB mutations could significantly impact bacterial adaptation and pathogenicity.

What experimental approaches can be used to study the interaction between atpB and host immune cells?

Several methodological approaches can be employed:

  • Cell-based co-culture systems:

    • Bacterial-leukocyte co-culture experiments using recombinant atpB

    • Measurement of cytokine production (IL-12p70, TNF-α, IL-6) via ELISA or cytometric bead arrays

    • Assessment of leukocyte survival and activation markers

  • Activity-based protein profiling (ABPP):

    • Use of desthiobiotin-ATP probes to target ATP-interacting proteins

    • Analysis of protein-protein interactions during host-pathogen dynamics

    • Identification of ATP-dependent processes in both bacterial and host cells

  • Proteomic approaches:

    • Comparative proteomics to identify differentially expressed proteins in response to atpB

    • Mass spectrometry analysis of protein complexes involving atpB

    • Phosphoproteomics to identify signaling pathways activated in response to ATP synthase components

  • In vivo infection models:

    • Mouse models to assess the impact of atpB mutations on immune cell recruitment and activation

    • Assessment of myeloid-derived suppressor cell (MDSC) and macrophage infiltration

    • Measurement of local and systemic inflammatory responses

  • Microscale thermophoresis (MST):

    • Analysis of protein-peptide interactions between atpB and host defense peptides

    • Determination of binding affinities and cooperative binding mechanisms

These approaches provide complementary data on how atpB influences host-pathogen interactions.

How can recombinant atpB be used in the development of antimicrobial strategies?

Research suggests several potential applications:

  • Vaccine development:

    • ATP synthase subunits as vaccine antigens due to their conservation and essential function

    • Assessment of protective immune responses targeting atpB in animal models

  • Drug target identification:

    • Structure-based drug design targeting specific regions of atpB

    • High-throughput screening for small molecule inhibitors of ATP synthase function

    • Assessment of synergistic effects with existing antibiotics

  • Biofilm disruption strategies:

    • Development of approaches to modulate atpB function to enhance biofilm clearance

    • Combination therapies targeting ATP synthase alongside conventional antibiotics

  • Host immune response modulation:

    • Targeting atpB to enhance proinflammatory responses in biofilm infections

    • Development of immunomodulatory therapies based on understanding atpB-host interactions

  • Diagnostic applications:

    • Use of recombinant atpB-specific antibodies for detection of staphylococcal infections

    • Development of rapid diagnostic tests based on ATP synthase detection

Antimicrobial StrategyMechanismPotential AdvantagesChallenges
ATP synthase inhibitorsDirect targeting of energy productionEssential target, low resistance potentialSelectivity over human ATP synthase
Biofilm disruptorsEnhancement of immune clearanceAddresses chronic infectionsDelivery to biofilm environment
Immunomodulatory approachesEnhancement of protective responsesWorks with host defensePotential inflammatory damage
Combination therapiesSynergistic action with antibioticsReduced resistance developmentComplex interactions

What challenges exist in expressing and purifying functional recombinant atpB?

Researchers face several technical challenges:

  • Membrane protein expression issues:

    • Toxicity to expression host due to membrane insertion

    • Low expression yields common with membrane proteins

    • Protein misfolding and inclusion body formation

  • Solubilization and stability:

    • Requirement for detergents that maintain protein structure

    • Finding optimal detergent/lipid conditions for functional activity

    • Protein aggregation during concentration steps

  • Functional assessment:

    • Need for reconstitution in lipid environments for activity assays

    • Complexity of multi-subunit ATP synthase complex reconstitution

    • Requirement for specialized equipment for functional analysis

  • Structural considerations:

    • Protein flexibility and conformational dynamics

    • Interactions with other ATP synthase subunits

    • Native lipid requirements for proper function

ChallengePotential SolutionsSuccess Metrics
Low expressionUse of specialized expression strains (C41/C43)Yield (mg/L culture)
Inclusion bodiesOptimization of induction conditions, fusion tagsPercentage of soluble protein
Detergent selectionScreening multiple detergents, lipid additionRetention of secondary structure
Functional reconstitutionProteoliposome preparation, nanodiscsATP hydrolysis activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.