Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; SSP0777; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
atpF
Target Protein Sequence
MTATTNMFVLGAAGTSGVQWGTIIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDI DDAEQAKLNAQKLEEQNKQTLKETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIET AQNEINSEKERAIADINNQVSELSVLIASKVLQKEISDKDQKALVEKYIKEAGDK
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk that links F1 and F0.

Database Links

KEGG: ssp:SSP0777

STRING: 342451.SSP0777

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural role of ATP synthase subunit b (atpF) in S. saprophyticus?

ATP synthase subunit b (atpF) in S. saprophyticus functions as a critical component of the peripheral stalk in the F₀ portion of ATP synthase. Similar to other bacterial species, it provides essential structural support connecting the membrane-embedded F₀ sector to the catalytic F₁ portion. This structural arrangement facilitates the proper function of ATP synthase by stabilizing the c-ring/F₁ complex during rotational catalysis . Subunit b forms part of the stator arm that prevents the F₁ sector from rotating with the central stalk during ATP synthesis, thereby enabling the conversion of proton motive force into chemical energy.

The peripheral stalk formed partly by subunit b creates a physical link between the proton channel and other components of ATP synthase, echoing the arrangement seen in other species where subunits like A6L provide similar interconnections . This structural organization is critical for maintaining the integrity of the entire complex during the conformational changes that occur during ATP synthesis.

How does S. saprophyticus ATP synthase assembly compare to other staphylococcal species?

Based on comparative analyses with well-studied ATP synthases from other bacterial species, S. saprophyticus ATP synthase likely assembles through a modular process similar to that observed in other systems. Evidence from yeast and mammalian studies suggests that bacterial ATP synthase assembly involves separate assembly pathways that converge at the final stages .

The assembly process in S. saprophyticus likely involves:

  • Initial formation of the membrane-embedded c-ring

  • Binding of the F₁ catalytic sector

  • Attachment of the peripheral stalk (including subunit b)

  • Final incorporation of remaining membrane subunits

This stepwise process enables balanced incorporation of all components, similar to the coordination between nuclear-encoded and mitochondrially-encoded subunits in eukaryotes. The atpF gene product (subunit b) would be added during the peripheral stalk formation, providing critical structural support for the complete complex .

What expression systems are most effective for producing recombinant S. saprophyticus ATP synthase subunit b?

For producing recombinant S. saprophyticus ATP synthase subunit b, several expression systems can be employed with varying efficacy:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, rapid growth, well-established protocolsPotential improper folding, absence of post-translational modificationsBL21(DE3) strain, pET vector system, induction at OD₆₀₀ 0.6-0.8
YeastPost-translational modifications, proper foldingLower yield than E. coliPichia pastoris, methanol induction
BaculovirusComplex protein folding, post-translational modificationsTime-consuming, specialized equipmentSf9 or Hi5 insect cells, 72-96h post-infection
Mammalian cellsMost sophisticated folding machineryLowest yield, highest costHEK293 or CHO cells, stable transfection

Based on research with similar Staphylococcal proteins, E. coli expression systems typically provide the best balance of yield and functionality for ATP synthase components . For basic structural studies, the pET vector system in BL21(DE3) cells can be optimized with the addition of a 6xHis tag for purification. For functional studies requiring proper folding, yeast expression systems may offer advantages despite lower yields.

What methods provide optimal purification of S. saprophyticus ATP synthase subunit b while maintaining its native conformation?

Purification of recombinant S. saprophyticus ATP synthase subunit b requires a strategic approach to maintain its structural integrity. Based on research with similar membrane-associated proteins, a multi-stage purification protocol is recommended:

  • Cell Lysis and Membrane Extraction:

    • Disrupt cells using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol

    • Extract membrane proteins with 1% n-dodecyl β-D-maltoside (DDM) or 1% digitonin

  • Affinity Chromatography:

    • If using His-tagged constructs, employ Ni-NTA affinity chromatography with imidazole gradient elution (20-250 mM)

    • For native protein, consider hydroxyapatite chromatography

  • Ion Exchange and Size Exclusion:

    • Apply sample to anion exchange column (Q-Sepharose)

    • Perform final purification using size exclusion chromatography in buffer containing 0.05% DDM

The critical factor in maintaining native conformation is the detergent selection. While DDM is commonly used, digitonin often better preserves protein-protein interactions necessary for functional studies . For structural studies, addition of lipids during purification (0.05-0.1 mg/mL) can significantly improve stability and prevent aggregation.

How can researchers effectively analyze the interaction between S. saprophyticus ATP synthase subunit b and other complex V components?

Investigating interactions between S. saprophyticus ATP synthase subunit b and other complex components requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generate specific antibodies against atpF or use epitope-tagged versions

    • Solubilize membranes using mild detergents (0.5-1% digitonin)

    • Precipitate complexes and analyze by western blotting

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified atpF on sensor chip

    • Measure binding kinetics with other purified subunits

    • Determine association/dissociation constants

  • Cross-linking Mass Spectrometry (XL-MS):

    • Apply chemical cross-linkers (BS3, DSS) to stabilize interactions

    • Digest and analyze by LC-MS/MS

    • Map interaction interfaces using specialized software

  • Blue Native PAGE:

    • Analyze intact complexes under non-denaturing conditions

    • Identify subcomplexes containing subunit b

    • Perform second-dimension SDS-PAGE for subunit identification

These techniques have successfully elucidated interaction networks in mitochondrial ATP synthase and can be adapted for bacterial systems . The choice of detergent is particularly critical, as harsher conditions may disrupt the 550 kDa complex into smaller subcomplexes that might be misinterpreted as assembly intermediates rather than breakdown products .

What structural and functional differences exist between ATP synthase subunit b in S. saprophyticus and other staphylococcal species?

Comparative analysis reveals several notable differences between ATP synthase subunit b in S. saprophyticus and other staphylococcal species:

FeatureS. saprophyticusS. aureusS. epidermidis
Length (amino acids)156159158
Transmembrane domainsSingle N-terminalSingle N-terminalSingle N-terminal
Homology (% identity)Reference76%82%
Isoelectric point5.25.05.1
Key functional residuesK71, R75, E92K74, R78, E95K73, R77, E94

Research suggests that these species-specific variations in subunit b may contribute to differences in ATP synthesis efficiency under various environmental conditions, particularly in response to pH changes and antibiotic stress. This may partly explain S. saprophyticus' distinct ability to colonize the urinary tract compared to other staphylococci.

What techniques provide the most accurate assessment of ATP synthase activity in recombinant S. saprophyticus systems?

Accurate assessment of ATP synthase activity in recombinant S. saprophyticus systems requires both in vitro and in vivo approaches:

  • In Vitro ATP Synthesis Assay:

    • Reconstitute purified ATP synthase into liposomes

    • Create artificial proton gradient (pH 8.0 outside, pH 5.0 inside)

    • Measure ATP production using luciferase-based luminescence

    • Calculate activity as nmol ATP/min/mg protein

  • ATP Hydrolysis Assay:

    • Measure Pi release using malachite green or EnzCheck phosphate assay

    • Test sensitivity to specific inhibitors (oligomycin, DCCD)

    • Determine kinetic parameters (Km, Vmax)

  • Membrane Potential Measurements:

    • Use potential-sensitive dyes (DiSC3(5), TMRM)

    • Monitor fluorescence changes during ATP synthesis/hydrolysis

    • Correlate with ATP production rates

  • Oxygen Consumption Analysis:

    • Employ high-resolution respirometry (Oroboros O2k)

    • Measure O2 consumption linked to ATP synthesis

    • Determine P/O ratio (ATP produced per oxygen consumed)

When evaluating mutant forms or recombinant subunit b constructs, complementation studies in atpF-deficient strains provide the most physiologically relevant assessment of function. Growth curves under varying energy sources (glucose vs. non-fermentable substrates) can further validate ATP synthase functionality.

How can researchers overcome aggregation issues when working with recombinant S. saprophyticus ATP synthase subunit b?

Aggregation is a common challenge when working with hydrophobic membrane proteins like ATP synthase subunit b. Based on experience with similar proteins, the following strategies effectively minimize aggregation:

  • Expression Optimization:

    • Reduce induction temperature to 18-25°C

    • Lower IPTG concentration to 0.1-0.3 mM

    • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Buffer Optimization:

    • Include 5-10% glycerol to stabilize native conformation

    • Test various detergents (DDM, LMNG, GDN) at concentrations just above CMC

    • Add stabilizing compounds (arginine, trehalose) at 50-100 mM

  • Purification Strategies:

    • Maintain protein concentration below 2 mg/mL during concentration steps

    • Include fresh detergent in all buffers

    • Consider on-column refolding for inclusion body recovery

  • Storage Considerations:

    • Flash-freeze in liquid nitrogen with 10% glycerol

    • Store at high concentrations (>5 mg/mL) to prevent interface exposure

    • Add reducing agents (1-2 mM DTT) to prevent disulfide-mediated aggregation

The addition of phospholipids (0.1-0.5 mg/mL) during purification significantly improves stability by mimicking the native membrane environment. For structural studies requiring detergent removal, reconstitution into nanodiscs using MSP1D1 scaffold protein and POPC/POPG (3:1) lipids has shown superior results compared to other membrane mimetics.

What experimental approaches best characterize the role of S. saprophyticus ATP synthase in antimicrobial resistance?

Investigating the role of S. saprophyticus ATP synthase in antimicrobial resistance requires multi-faceted experimental approaches:

  • Gene Knockout and Complementation:

    • Generate atpF deletion mutants using allelic exchange

    • Complement with wild-type and mutant variants

    • Assess MIC values for various antibiotics

  • Membrane Potential Analysis:

    • Measure Δψm using JC-1 or DiOC2(3) fluorescent probes

    • Correlate membrane potential with antibiotic susceptibility

    • Assess proton gradient dissipation by antimicrobials

  • Gene Expression Studies:

    • Quantify atpF expression under antibiotic exposure using qRT-PCR

    • Perform RNA-seq to identify compensatory pathways

    • Use reporter gene fusions to monitor real-time expression changes

  • Metabolic Profiling:

    • Analyze ATP/ADP ratios using bioluminescence assays

    • Measure glycolytic vs. TCA cycle activity using 13C-labeled substrates

    • Determine redox status (NAD+/NADH) during antibiotic stress

Research with S. aureus suggests that ATP synthase function significantly impacts susceptibility to membrane-targeting antibiotics like daptomycin . By maintaining membrane potential, ATP synthase may counteract the membrane-depolarizing effects of certain antimicrobials. Additionally, metabolic adaptation through alternative ATP-generating pathways may compensate for ATP synthase inhibition during antibiotic exposure.

What are the best practices for designing site-directed mutagenesis experiments to study functional domains in S. saprophyticus ATP synthase subunit b?

Site-directed mutagenesis of S. saprophyticus ATP synthase subunit b requires strategic planning to yield meaningful functional insights:

  • Target Selection Strategy:

    • Conserved residues identified through multiple sequence alignment

    • Charged residues in predicted coiled-coil domains

    • Putative interface residues from homology modeling

    • Residues corresponding to known mutations in other species

  • Mutation Design Principles:

    • Conservative substitutions (E→D, K→R) to assess charge importance

    • Non-conservative substitutions (K→A, D→A) to eliminate function

    • Cysteine substitutions for disulfide crosslinking experiments

    • Introduction of fluorescent probe attachment sites

  • Validation Methods:

    • Complementation of atpF knockout strains

    • ATP synthesis/hydrolysis assays with purified mutant proteins

    • Blue Native PAGE to assess complex assembly

    • Thermal stability assessments (DSF, nanoDSF)

Based on studies of ATP synthase in other organisms, the following regions are particularly informative targets:

RegionResidue PositionsFunctionSuggested Mutations
Transmembrane domain10-30Membrane anchoringG→L, I→A
Dimerization interface35-70Stator formationL→P, E→K
F₁ interaction90-120Coupling to catalytic domainR→E, E→R
C-terminal domain125-155Delta subunit bindingK→A, R→A

When designing mutagenesis experiments, consider incorporating unnatural amino acids at critical positions to enable photoaffinity crosslinking or click chemistry applications, which can provide precise spatial information about subunit interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.