Recombinant Staphylococcus saprophyticus subsp. saprophyticus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction

Glycerol-3-phosphate acyltransferase (PlsY) is a membrane-integral enzyme critical for bacterial phospholipid biosynthesis. In Staphylococcus saprophyticus, PlsY catalyzes the committed step of acylation using glycerol-3-phosphate (G3P) and acyl-phosphate to form lysophosphatidic acid (lysoPA), a precursor for membrane lipids . Unlike eukaryotic homologs, PlsY is essential in Gram-positive bacteria and represents a target for antimicrobial development due to its absence in humans . Recombinant PlsY refers to the enzyme produced via heterologous expression systems for structural and functional studies.

Table 1: Critical residues in PlsY’s catalytic activity

ResidueRoleMutation Effect (Activity Loss)
Ser35Phosphate clamp>90% (S35C, S35T)
Arg45G3P phosphate stabilization>90% (R45K)
His1772-OH group coordination>99% (H177A)
Asn180Phosphate binding>95% (N180D)

Catalytic Mechanism and Substrate Specificity

PlsY employs a substrate-assisted catalysis mechanism:

  • No protein catalytic base: Unlike conventional acyltransferases (e.g., PlsB), PlsY relies on the G3P 1-hydroxyl group for nucleophilic attack on acyl-phosphate .

  • Acyl donor specificity: Uses acyl-phosphate (acylP) instead of acyl-CoA or acyl-carrier protein, a unique feature among bacterial GPATs .

  • Kinetic parameters: Reported KmK_m for G3P ranges from 0.3–0.5 mM in Aquifex aeolicus PlsY, with similar kinetics inferred for S. saprophyticus .

Genetic and Functional Insights

  • Essentiality: PlsY is indispensable in S. saprophyticus for phospholipid biosynthesis, akin to other Gram-positive pathogens like Enterococcus faecium .

  • Lineage-specific adaptations: Comparative genomics suggests horizontal acquisition of lipid metabolism genes in S. saprophyticus, though direct evidence for plsY transfer remains unexplored .

  • Biofilm linkage: While S. saprophyticus biofilms are protein-dominated, PlsY’s role in membrane lipid synthesis may indirectly support biofilm stability .

Inhibitor Development and Antimicrobial Potential

PlsY is a validated target for antimicrobials:

  • Acyl-sulfamate inhibitors: Show efficacy against Staphylococcus aureus PlsY (IC50_{50} < 1 μM) .

  • High-throughput screening: A fluorescence-based assay using recombinant PlsY enables rapid inhibitor discovery .

Table 2: PlsY vs. eukaryotic GPATs

FeaturePlsY (Bacterial)Eukaryotic GPATs
Acyl donorAcyl-phosphateAcyl-CoA/ACP
Catalytic baseSubstrate-assistedAsp-His dyad
Membrane localizationIntegral (7-TMH)ER/mitochondrial-associated
EssentialityYes (Gram-positive)Non-essential (isoform redundancy)

Future Directions

  • Targeted mutagenesis: Explore plsY knockouts in S. saprophyticus to validate essentiality and biofilm interactions.

  • Structure-guided drug design: Leverage PlsY’s resolved active site to optimize acyl-sulfamate derivatives .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we will accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments include standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SSP1405; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
plsY
Target Protein Sequence
MMIVIMLILSYLIGAFPSGYVIGKLFFKKDIRQFGSGNTGATNSFRVLGKPAGFLVTFLD IFKGFIVVFFPLWLPVQAEGPITTFFTNGLIVGAFAILGHVYPVYLGFKGGKAVATSAGV ILGVNPVLLLILAAIFFGILYLTKYVSLSSIIASICCVIGALLIRDYILFIVSIGVGVLL IIRHRTNIVRIFKGEEPKIKWM
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as a fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: ssp:SSP1405

STRING: 342451.SSP1405

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are most effective for isolating the plsY gene from Staphylococcus saprophyticus?

Standard molecular cloning techniques remain effective for isolating the plsY gene from S. saprophyticus. The process typically involves:

  • Genomic DNA extraction from pure cultures

  • PCR amplification using primers designed based on conserved regions of the plsY gene

  • Cloning into an appropriate expression vector

  • Verification through sequencing

When designing primers, researchers should account for the substantial genomic diversity observed in S. saprophyticus. Studies have shown that while the core genome contains approximately 1798 genes, the pan genome includes an additional 7110 genes, highlighting significant variability in gene content . This genetic diversity necessitates careful primer design, potentially targeting highly conserved regions flanking the plsY gene.

How does the genetic structure of plsY in S. saprophyticus compare to other Staphylococcus species?

The plsY gene in S. saprophyticus shows evolutionary relationships with other staphylococcal species, but with distinct characteristics reflecting its adaptation to specific niches. Comparative genomic analyses reveal:

  • Conservation of core functional domains across Staphylococcus species

  • Variable regulatory regions reflecting niche-specific adaptations

  • Evidence of recombination events affecting gene evolution

Research indicates that S. saprophyticus has a recombination to mutation ratio (r/m) of approximately 1.2, which is similar to S. aureus (r/m ≈ 1) . This moderate level of recombination has likely contributed to the evolution of genes like plsY, though at a lower rate than seen in some other bacterial species with wide host ranges.

What are the standard methods for recombinant expression of S. saprophyticus plsY?

The recombinant expression of S. saprophyticus plsY typically follows these methodological steps:

  • Selection of an appropriate expression system (common choices include E. coli BL21(DE3) for high yield or B. subtilis for better folding of Gram-positive proteins)

  • Optimization of codon usage for the host organism

  • Addition of affinity tags (His-tag, GST-tag) for purification

  • Induction conditions optimization (temperature, IPTG concentration, duration)

When designing experimental treatments for expression optimization, researchers should systematically manipulate independent variables such as temperature, inducer concentration, and expression duration . For example, a factorial design might test expression at 16°C, 25°C, and 37°C against IPTG concentrations of 0.1mM, 0.5mM, and 1.0mM to determine optimal conditions.

How do selective sweeps and recombination events affect plsY evolution in S. saprophyticus populations?

The evolution of functional genes like plsY in S. saprophyticus appears to be influenced by both selective sweeps and recombination events:

  • Genomic analyses have identified marked regional decreases in nucleotide diversity (π) and Tajima's D (TD) in certain lineages, indicating selective sweeps

  • While recombination affects approximately 70% of sites in the S. saprophyticus genome, some functionally important loci show fewer recombinant tracts

  • Inter-clade recombination appears rare, suggesting reproductive isolation between major clades

Researchers investigating plsY evolution should employ sliding window analyses of diversity and calculate Weir and Cockerham's FST to identify potential signatures of selection. These approaches can pinpoint candidate variants under positive selection, as demonstrated in studies of other S. saprophyticus virulence factors .

What experimental design is most appropriate for investigating plsY's role in S. saprophyticus pathogenesis?

A robust experimental design for investigating plsY's role in pathogenesis would include:

Experimental ComponentImplementation StrategyRationale
Control groupsWild-type S. saprophyticusEstablishes baseline pathogenesis
Experimental groupsplsY knockout, complemented strains, point mutantsIsolates specific gene effects
Variable manipulationExpression levels, point mutations in catalytic sitesTests specific functional hypotheses
Host modelsCell culture, animal models with appropriate controlsTests pathogenesis in relevant contexts
Measurement parametersGrowth curves, membrane composition analysis, virulence assaysQuantifies phenotypic effects

True experimental design requires random assignment to control for extraneous variables . For in vivo experiments, this means randomly assigning laboratory animals to different treatment groups to ensure that observed effects are attributable to plsY manipulation rather than pre-existing differences between animal groups.

How does metabolic niche adaptation influence the function and expression of plsY in different S. saprophyticus lineages?

Research on S. saprophyticus has revealed significant metabolic differences between major clades that may influence plsY function and expression:

  • Differential maintenance of metabolic genes between clades (e.g., beta-galactosidase)

  • Distinct metabolic niches potentially creating barriers to horizontal gene transfer

  • Possible co-adaptation of membrane composition genes (including plsY) with metabolic capabilities

For example, studies have found that 97% of Clade 1 isolates carry the gene encoding beta-galactosidase (ebgA), compared to only 30% of Clade 2 isolates . These metabolic differences may indirectly affect membrane composition requirements and thus plsY function or regulation.

What methods are most effective for analyzing the impact of plsY variants on phospholipid biosynthesis in S. saprophyticus?

Comprehensive analysis of plsY's role in phospholipid biosynthesis requires multi-faceted approaches:

  • Lipidomic analysis using LC-MS/MS to quantify membrane phospholipid composition

  • Radioactive labeling with 14C-acetate to track phospholipid synthesis rates

  • Site-directed mutagenesis of catalytic residues to establish structure-function relationships

  • Enzyme kinetics assays using purified recombinant plsY and various acyl-ACP substrates

When designing these experiments, it's critical to control for extraneous variables by:

  • Standardizing growth conditions across all samples

  • Including appropriate positive and negative controls

  • Accounting for batch effects in multi-day experiments

  • Implementing true experimental design with random assignment

What are the best practices for addressing reproducibility challenges in plsY functional studies?

Enhancing reproducibility in plsY functional studies requires:

  • Detailed documentation of experimental protocols, including media composition, growth conditions, and strain construction methods

  • Standardization of key reagents, particularly for enzymatic assays

  • Implementation of appropriate statistical analyses and sample sizes

  • Consideration of potential confounding variables

Researchers should follow true experimental design principles, including control groups, variable manipulation, and random distribution . For example, when testing plsY enzyme activity, researchers should randomly assign technical replicates to different reaction batches and days to control for systematic errors.

How can researchers integrate genomic and functional data to understand plsY evolution in S. saprophyticus?

Integrative approaches to understanding plsY evolution include:

  • Phylogenetic analysis of plsY sequences across S. saprophyticus isolates from diverse niches

  • Correlation of genetic variants with phenotypic characteristics

  • Structural modeling of plsY variants to predict functional impacts

  • Experimental validation of computational predictions

Given that S. saprophyticus shows high diversity in accessory gene content (~14,000 genes in the pangenome) , researchers should consider how horizontally acquired genes might interact with plsY function. Studies have shown that despite moderate intra-clade recombination, inter-clade recombination is rare , which may lead to co-evolution of plsY with other genes specific to each clade.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.