Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme sensor protein hssS (hssS)

Shipped with Ice Packs
In Stock

Description

Function of Heme Sensor Proteins

Heme sensor proteins are essential in bacteria for detecting and responding to heme, a key iron-containing molecule. These proteins typically regulate gene expression related to iron acquisition and utilization, ensuring that the bacterium maintains optimal iron levels while avoiding toxicity. In pathogens like Staphylococcus saprophyticus, such proteins can influence virulence by facilitating survival in iron-restricted environments, such as those encountered during host infection.

Research Findings on Staphylococcus saprophyticus

While specific studies on the hssS protein are scarce, research on Staphylococcus saprophyticus highlights its pathogenic capabilities and resistance mechanisms. For instance, S. saprophyticus exhibits high resistance to heavy metals, mediated by genes like copA, copB, and copZ for copper resistance . Additionally, the bacterium forms biofilms, which are complex communities of bacteria and extracellular matrix components, contributing to its persistence in host environments .

Biochemical Characteristics of hssS

Given the lack of specific data on hssS, general characteristics of heme sensor proteins can be applied:

  • Function: Regulates gene expression in response to heme availability.

  • Structure: Typically contains heme-binding domains that facilitate sensing.

  • Role in Pathogenesis: Could influence bacterial survival and virulence by optimizing iron homeostasis.

Data Tables

Due to the limited availability of specific data on the hssS protein, the following table summarizes general information about Staphylococcus saprophyticus and related proteins:

Protein/FeatureDescriptionRelevance to hssS
SdrICollagen-binding protein in S. saprophyticusIllustrates surface protein functions in S. saprophyticus
Heme Sensor ProteinsRegulate iron homeostasis in bacteriaGeneral function relevant to hssS
Biofilm FormationContributes to bacterial persistenceMay interact with hssS in pathogenesis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping method includes standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
hssS; SSP0540; Heme sensor protein HssS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
hssS
Target Protein Sequence
MFKSLYTRIAIYTITVMIFSAVASFLCTNIIYHNYLKENNDAKIMRTLKDSIQYQKESRI EASAPFFKHLGEMNYQVMTISEDGHRTYYGTEFRKDNISKKTAESVLHGKDYHGIKNLPY NPIITGFFENTTKNTVGIAYQSKGHTYAVFMRPDIGKTFSEFRIFLAILITLLLLFSIIL VISSTYAIIKPIQQLKRATERLMHGNFDEVIHVTRKDEFGTLQYRFDKMRLSLKQLDDMR QHFVQNVSHEIKTPLTHIHHLLDLLKFAKTDNAREQYIEEIYEVTTQLSELTKALLLLSE IDNGAHLDFDDDIQLNQLIKKIIRHEQFSANEKDLIIMSDLETISMNGNERLLHQAFQNL ITNAIKYSTTGGMVDVTLSQNLETITCTITDDGQGMSAETQARIFERFYKSSNHDNSNGL GLAIAKAIFELHHGTITVDSEKNAGTTFTITFKKVPKTIS
Uniprot No.

Target Background

Function

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme sensor protein hssS (hssS)

HssS is a component of the two-component regulatory system HssS/HssR, crucial for intracellular heme homeostasis and modulation of staphylococcal virulence. HssS functions as a heme-sensing histidine kinase. It undergoes autophosphorylation at a histidine residue, subsequently transferring the phosphate group to an aspartate residue on HssR. The HssR/HssS complex activates the expression of hrtAB, an efflux pump, in response to extracellular heme, hemin, hemoglobin, or blood.

Database Links

KEGG: ssp:SSP0540

STRING: 342451.SSP0540

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the HssS protein and what is its function in Staphylococcus species?

HssS (heme sensing system S) functions as a membrane sensor protein that detects the presence of heme in the bacterial environment. It is part of the two-component heme sensing system (HssRS) that helps bacteria counteract environmental heme toxicity. When activated by heme, HssS triggers a phosphotransfer mechanism that leads to the expression of the heme efflux system HrtBA, which prevents intracellular accumulation of heme . This detoxification system is particularly important for bacterial survival during infection, as pathogenic bacteria are exposed to heme in host blood, which can concentrate in their lipid membranes and generate cytotoxicity .

How is the HssS protein structurally characterized?

HssS is characterized as a HisKA-type histidine kinase that exists as a membrane-bound homodimer. The protein contains an extracellular sensor domain and a cytoplasmic conserved catalytic domain . Recent structural simulations based on Alphafold2 have identified a heme-binding hydrophobic cavity within the transmembrane domains (TM) helices at the interface with the extracellular domain . In this model, heme is embedded in the membrane bilayer with its two protruding porphyrin propionates interacting with two conserved arginine residues (Arg94 and Arg163) that are located extracellularly .

What experimental approaches are used to study HssS activation?

Researchers typically employ several methodological approaches to study HssS activation:

  • Reporter systems: Fluorescent reporters (e.g., GFP) fused to the promoter of HrtBA (PhrtBA-GFP) allow visualization of HssS activation kinetics in response to heme .

  • Western blotting: Detection of HrtB expression using specific antibodies can confirm HssS activation .

  • Beta-galactosidase assays: PhrtBA-lac reporters are used to quantitatively measure HssS activation in response to varying concentrations of heme .

  • Mutagenesis studies: Site-directed mutagenesis of key residues (e.g., Arg94, Arg163, T253) helps identify amino acids critical for heme sensing and signal transduction .

  • Pyridine hemochrome assays: These are used to quantify intracellular heme accumulation in wild-type versus mutant strains .

How does the mechanism of HssS activation differ between S. aureus and S. saprophyticus?

While both S. aureus and S. saprophyticus possess the HssS protein, there are notable differences in their activation mechanisms. In S. aureus, HssS activation has been extensively characterized, showing a transient activation pattern in response to heme exposure . The HssS dimer forms a heme-binding hydrophobic cavity within the transmembrane domain helices at the interface with the extracellular domain, with conserved arginine residues (Arg94 and Arg163) playing crucial roles in heme binding .

For S. saprophyticus, the research is less extensive, but comparative genomics reveal that this species exhibits significant genetic plasticity, adapting to diverse environments . S. saprophyticus appears to be panmictic with a fluid population structure, suggesting potential variability in sensing mechanisms across different strains . The species is divided into two major clades with distinct genetic characteristics, including differences in restriction-modification systems and metabolic capacities that may influence various cellular functions including sensing mechanisms .

When designing experiments to compare the two species, researchers should account for these genomic differences and consider using comparative approaches that examine both structural conservation and functional divergence of the HssS protein.

What are the optimal experimental conditions for expressing and purifying recombinant HssS from S. saprophyticus?

Based on research methodologies used for similar membrane proteins, the following optimized protocol is recommended:

  • Expression system selection: E. coli BL21(DE3) strains are typically suitable, though C41(DE3) or C43(DE3) strains may provide better yields for membrane proteins.

  • Construct design: The full-length HssS protein contains transmembrane domains that complicate purification. Consider expressing either:

    • The soluble cytoplasmic domain for kinase activity studies

    • The full-length protein with fusion tags to enhance stability and solubility

  • Induction conditions: Low-temperature induction (16-18°C) with reduced IPTG concentration (0.1-0.3 mM) over extended periods (16-20 hours) typically yields better results for membrane proteins.

  • Membrane extraction: Use a mild detergent screening approach, testing detergents such as DDM, LMNG, or digitonin to identify optimal solubilization conditions.

  • Purification strategy: Employ a two-step purification using affinity chromatography (Ni-NTA for His-tagged constructs) followed by size exclusion chromatography.

When working specifically with S. saprophyticus HssS, researchers should be aware of potential clade-specific variations that might affect protein expression and folding properties .

How can researchers accurately assess HssS-heme interactions in vitro?

Multiple complementary approaches are recommended for comprehensive analysis of HssS-heme interactions:

  • Spectroscopic analysis: UV-visible spectroscopy can detect characteristic shifts in heme absorption spectra upon binding to HssS. The Soret band typically shifts from ~385 nm (free heme) to ~410-420 nm when bound to the protein.

  • Isothermal titration calorimetry (ITC): This provides quantitative binding parameters including dissociation constants (Kd), binding stoichiometry, and thermodynamic values (ΔH, ΔS).

  • Surface plasmon resonance (SPR): Offers real-time binding kinetics and affinity measurements.

  • Fluorescence quenching: If the HssS protein contains tryptophan residues near the heme-binding site, intrinsic fluorescence quenching can be measured upon heme binding.

  • Mutagenesis studies: Creating alanine substitutions of key residues (particularly at the Arg94 and Arg163 positions identified in S. aureus) can verify the importance of these residues for heme binding in S. saprophyticus HssS .

When interpreting results, researchers should consider that in vivo, HssS is embedded in the membrane with heme likely approaching from the membrane environment rather than from solution .

What strategies can overcome challenges in membrane protein expression for HssS studies?

Membrane proteins like HssS present significant expression and purification challenges. Implement these research-validated approaches:

  • Expression optimization matrix:

ParameterRecommended RangeNotes
Host strainBL21(DE3), C41(DE3), C43(DE3)C41/C43 are engineered for membrane proteins
Growth temperature16-30°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMStart with lower concentrations
MediaLB, TB, 2XYT, M9TB often yields higher biomass
Induction OD6000.6-1.0Mid-log phase typically optimal
InducerIPTG, auto-inductionAuto-induction provides gradual expression
  • Solubilization strategy: Screen multiple detergents at various concentrations above their critical micelle concentration (CMC). Include newer amphipathic polymers like SMA (styrene-maleic acid) that can extract membrane proteins with their native lipid environment intact.

  • Fusion partners: Consider fusion tags known to enhance membrane protein solubility, such as MBP (maltose-binding protein) or SUMO.

  • Cell-free expression systems: These can be particularly effective for difficult membrane proteins as they allow direct integration into supplied lipid environments.

  • Nanodiscs or liposome reconstitution: For functional studies, reconstituting purified HssS into nanodiscs or liposomes can maintain native-like membrane environments.

When working specifically with S. saprophyticus HssS, consider the clade-specific variations that might necessitate adjustments to these protocols .

How can researchers distinguish between direct and indirect effects when studying HssS activation?

Establishing causality in HssS activation requires multiple complementary approaches:

  • Controls for specificity:

    • Use structurally similar but non-activating compounds alongside heme

    • Include non-related membrane stressors to rule out general membrane stress responses

    • Compare wild-type responses to hssS deletion mutants

  • Direct binding assays:

    • In vitro binding studies with purified components

    • Microscale thermophoresis or ITC to establish direct interaction

    • Surface plasmon resonance to determine binding kinetics

  • Structure-function validation:

    • Site-directed mutagenesis of predicted binding residues (Arg94, Arg163)

    • Chimeric protein constructs swapping domains between related sensors

    • Phosphorylation assays to directly measure HssS kinase activity

  • Temporal resolution:

    • Time-course experiments to establish order of events

    • Pulse-chase experiments to track heme movement

    • Real-time monitoring of HssS conformational changes

  • Genetic approaches:

    • Epistasis analysis with related signaling components

    • Suppressor screens to identify compensatory mutations

    • Transcriptomics to identify the complete regulon

When interpreting data, researchers should be aware that HssS activation appears to be transient and correlates with intracellular heme pools rather than exclusively with extracellular heme as previously thought .

What are the key considerations for designing HssS mutation studies?

When designing mutation studies for HssS, researchers should consider:

  • Structure-guided approach:

    • Utilize available structural models (e.g., the Alphafold2-based model)

    • Target residues in predicted functional regions:

      • Heme-binding pocket (hydrophobic residues)

      • Porphyrin propionate interaction sites (particularly Arg94 and Arg163)

      • Dimerization interface

      • Signal transmission regions between domains

      • Catalytic sites (e.g., T253 for phosphotransfer)

  • Conservation analysis:

    • Compare HssS sequences across Staphylococcus species

    • Focus on highly conserved residues within functional domains

    • Consider clade-specific variations within S. saprophyticus

  • Mutation types:

    • Conservative substitutions to test physicochemical properties

    • Alanine scanning for systematic functional mapping

    • Cysteine substitutions for accessibility studies and crosslinking

    • Phosphomimetic mutations (D/E) or phosphoablative mutations (A) for signaling studies

  • Functional readouts:

    • PhrtBA-GFP reporter assays to measure signaling output

    • Phosphorylation assays to measure kinase activity

    • Heme binding assays to measure direct interaction

    • Growth assays in high-heme conditions to assess physiological relevance

  • Control experiments:

    • Verify protein expression levels of mutants

    • Confirm membrane localization and proper folding

    • Test multiple heme concentrations to establish dose-response relationships

When conducting these studies in S. saprophyticus, researchers should be mindful of the potential differences between the two major clades, which might affect protein structure and function .

How should researchers interpret conflicting data on HssS activation kinetics?

Conflicting results regarding HssS activation kinetics may arise from several factors. A systematic approach to resolving these conflicts includes:

  • Experimental condition analysis:

    • Compare growth phases when measurements were taken (HssS activation appears highly dependent on growth phase)

    • Assess differences in heme concentrations used (subtoxic vs. toxic)

    • Evaluate heme delivery methods (free hemin vs. hemoglobin-bound)

    • Consider strain backgrounds (wild-type vs. deletion mutants)

  • Reporter system considerations:

    • Different reporter systems (GFP, β-galactosidase) have varying sensitivity and temporal resolution

    • Protein-level detection (Western blot) versus transcriptional reporters may show time lags

    • Reporter stability affects apparent activation duration

  • Reconciliation strategies:

    • Time-course experiments with multiple readouts in parallel

    • Single-cell analysis to detect population heterogeneity

    • Mathematical modeling to integrate datasets with different temporal resolutions

  • Biological explanations for apparently conflicting data:

    • HssS exhibits dual activity as both kinase and phosphatase

    • Activation is transient and growth-phase dependent

    • Intracellular heme pools rather than extracellular concentrations may drive activation

    • Feedback regulation through HrtBA expression affects activation dynamics

When analyzing data from S. saprophyticus specifically, consider that the two major clades exhibit differences in gene content and metabolic capacity that might influence sensor kinetics .

What statistical approaches are most appropriate for analyzing heme-dependent HssS activation data?

For robust statistical analysis of HssS activation data:

  • Experimental design considerations:

    • Include biological replicates (minimum n=3)

    • Technical replicates should account for instrument variation

    • Include appropriate positive and negative controls

    • Plan for time-course analysis with sufficient temporal resolution

  • Data normalization strategies:

    • Normalize to cell density (OD600)

    • Consider internal reference genes for RT-qPCR data

    • Account for background fluorescence in reporter assays

    • Use appropriate housekeeping proteins for Western blot normalization

  • Statistical tests for different scenarios:

    • Dose-response relationships: Non-linear regression models

    • Time-course data: Repeated measures ANOVA or mixed-effects models

    • Mutant comparisons: Two-way ANOVA with post-hoc tests

    • Correlation analyses: Pearson or Spearman depending on data distribution

  • Advanced analytical approaches:

    • Principal component analysis for multivariate data

    • Hierarchical clustering for identifying patterns across multiple conditions

    • Mathematical modeling for kinetic parameter estimation

    • Bayesian approaches for integrating prior knowledge with new data

  • Reporting standards:

    • Always include measures of dispersion (SD or SEM)

    • Report exact p-values rather than thresholds

    • Use appropriate graphical representations (time-courses for kinetic data)

    • Consider data transformations only when justified by distribution characteristics

When analyzing data across different strains of S. saprophyticus, researchers should be aware of the clade structure identified through comparative genomics and consider it as a potential factor in their analyses .

How does horizontal gene transfer impact HssS function across Staphylococcus species?

Horizontal gene transfer (HGT) plays a significant role in the evolution of sensing systems across bacterial species. For HssS specifically:

  • Evolutionary implications:

    • Comparative genomics reveals that S. saprophyticus exists in two major clades with barriers to horizontal gene transfer between them

    • These barriers include differences in restriction-modification systems that limit DNA exchange

    • Such barriers likely influence the evolution of sensing systems like HssS across different lineages

  • Functional consequences:

    • HGT events can introduce novel sensing capabilities or alter existing ones

    • For example, the Type VII secretion system (T7SS) appears to have been horizontally acquired multiple times in S. saprophyticus, particularly in bovine mastitis isolates

    • Similarly, heme sensing components may show evidence of HGT, potentially conferring adaptive advantages in specific niches

  • Research approaches to study HGT impacts:

    • Phylogenetic analyses to identify incongruence between gene and species trees

    • Comparative sequence analysis to detect signatures of recent HGT events

    • Functional characterization of HssS orthologs from different species and clades

    • Experimental evolution studies under heme selection pressure

  • Experimental considerations:

    • When studying HssS function, researchers should consider the clade origin of their strains

    • Comparative studies should include representatives from different clades to capture functional diversity

    • Chimeric constructs between HssS variants can help map functional differences resulting from HGT events

The panmictic nature of S. saprophyticus populations, with diverse bacteria associated with individual environments, suggests complex evolutionary dynamics that likely influence heme sensing capabilities across strains .

What is the relationship between HssS sensor systems and virulence in S. saprophyticus infections?

The relationship between heme sensing and virulence in S. saprophyticus involves multiple interconnected aspects:

  • Pathoadaptation mechanisms:

    • Heme sensing via HssS allows adaptation to heme-rich host environments

    • S. saprophyticus appears to be a generalist capable of adapting to diverse environments, including transition to pathogenic niches

    • Specific genomic adaptations may allow certain strains to cause infections while maintaining environmental versatility

  • Comparative virulence factors:

    • While the Type VII secretion system (T7SS) has been associated with virulence in S. aureus and is found predominantly in mastitis-causing S. saprophyticus strains , the role of heme sensing in this context remains to be fully elucidated

    • The dual role of HssS as both kinase and phosphatase suggests fine-tuned regulation during infection processes

  • Host-pathogen interactions:

    • HssS activation appears to correlate with intracellular heme accumulation rather than exclusively extracellular sensing

    • This suggests adaptability to changing host environments during infection progression

    • The transient nature of HssS activation may reflect strategic responses to host defense mechanisms

  • Research directions:

    • Infection models comparing wild-type and hssS mutant strains

    • Transcriptomic analysis under infection-mimicking conditions

    • In vivo imaging of HssS activation during infection progression

    • Comparative analysis of HssS function in commensal versus pathogenic isolates

  • Therapeutic implications:

    • The heme-binding hydrophobic cavity in HssS represents a potential target for antimicrobial development

    • Inhibitors of heme sensing could potentially attenuate virulence without imposing strong selection pressure

Researchers studying S. saprophyticus pathogenesis should consider the fluid population structure and panmictic nature of this species when designing experiments and interpreting results .

How can computational modeling enhance our understanding of HssS-mediated signaling pathways?

Computational approaches offer powerful tools for investigating complex signaling systems like HssS:

  • Structural modeling advancements:

    • Alphafold2 and similar AI-based tools have already provided valuable structural insights into HssS

    • Molecular dynamics simulations can further elucidate:

      • Heme binding mechanisms

      • Conformational changes upon activation

      • Signal transmission between domains

      • Interactions with membrane environments

  • Systems biology approaches:

    • Kinetic modeling of the complete HssRS signaling pathway

    • Parameter estimation from experimental time-course data

    • Sensitivity analysis to identify key control points

    • Integration with metabolic models to predict system-wide effects

  • Comparative genomics applications:

    • Identification of conserved regulatory motifs across species

    • Prediction of co-evolving residues important for function

    • Reconstruction of the evolutionary history of heme sensing systems

    • Integration with population structure data to understand adaptation to different niches

  • Machine learning opportunities:

    • Pattern recognition in activation dynamics across conditions

    • Prediction of mutations that alter sensor function

    • Classification of strains based on sensing capabilities

    • Integration of multi-omics data to identify regulatory networks

  • Implementation strategies:

    • Collaborative approaches combining wet-lab validation with computational prediction

    • Iterative model refinement based on experimental feedback

    • Open-source tool development for the bacterial sensing research community

    • Integration of models across scales (molecular to population)

For S. saprophyticus specifically, computational models should account for the clade structure and metabolic differences identified through comparative genomics , as these may influence signaling dynamics in different strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.