Recombinant Staphylococcus saprophyticus subsp. saprophyticus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC in Staphylococcus saprophyticus

YidC belongs to the Oxa/Alb/YidC family of insertases, conserved across bacteria, mitochondria, and chloroplasts. In Staphylococcus saprophyticus, YidC plays a pivotal role in Sec-independent and Sec-dependent membrane protein integration, impacting cellular processes like energy metabolism and stress adaptation . Its recombinant form enables structural and functional studies, particularly in antimicrobial development .

Production and Purification

Recombinant YidC is produced in heterologous systems with the following specifications :

ParameterDetails
Host SystemE. coli, yeast, baculovirus, or mammalian cells
TagN-terminal His tag
Purity≥85% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for storage

Research Applications

Recombinant YidC enables:

  • Mechanistic Studies: Elucidating Sec-YidC translocon dynamics .

  • Drug Discovery: High-throughput screening for YidC inhibitors (e.g., synergistic compounds like eugenol) .

  • Structural Biology: Cryo-EM and X-ray crystallography to resolve substrate-binding grooves .

Comparative Analysis of YidC in Staphylococcus Species

YidC distribution varies across Staphylococcus species, influencing their susceptibility to YidC-targeting agents :

SpeciesYidC1YidC2Cpd36 MIC (μg/mL)Cpd46 MIC (μg/mL)
S. aureus+10.5
S. saprophyticus++22
S. epidermidis+10.5

Future Directions

Further studies should address:

  • Structural Resolution: Full-length S. saprophyticus YidC topology.

  • Pathogenicity Link: Role in biofilm formation and urinary tract infections .

  • Therapeutic Optimization: Leveraging recombinant YidC for target-specific antibiotic design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Kindly consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; SSP0793; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-289
Protein Length
Full Length of Mature Protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
yidC
Target Protein Sequence
CDYSKPENRDGFFYNTFYVPMDNVIHWLGTSFNNDYGLAIVVLVLVIRIVLLPFMLSNYK NSHMMREKMKVAKPDIDAIQEKVKRSRTQEEKMAANSEMMEVYKKYDMNPMKSMLGCLPI LIQMPIIMGLFFVLKYPSSGGFTEHPYFLWFNLAKPDIWITIIAGILYFLQAYVSSKSMP AEQRQMGYMMMVISPIMIVWISFSSVSALGLYWSVSAAFLIVQTQVANMYYSKLAQREVA PMIEAMEKNKAEASGKGKNTQVVSKKNKKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Database Links

KEGG: ssp:SSP0793

STRING: 342451.SSP0793

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC in bacterial membrane protein biogenesis?

YidC serves as an essential membrane protein insertase in bacteria, playing a critical role in the insertion and folding of proteins into the inner membrane. YidC can function through multiple pathways: (1) it can associate with the Sec translocon to facilitate the lateral insertion of transmembrane segments as they exit the Sec complex; (2) it can act upstream of the Sec translocon, as demonstrated for proteins like the lipoprotein CyoA; and (3) it can independently catalyze the insertion of certain membrane proteins without requiring the Sec machinery .

How is the yidC gene organized within bacterial genomes?

The yidC gene is located within a highly conserved gene cluster in Gram-negative bacteria. The consistent gene order is rpmH, rnpA, yidD, yidC, and trmE . This conservation suggests coordinated gene expression and related functions among these genes. The cluster contains genes involved in protein synthesis and membrane targeting, indicating the integrated nature of these cellular processes .

In E. coli, three promoters have been identified upstream of rpmH, one of which generates a polycistronic mRNA. The yidD gene overlaps with rnpA by 37 bp and is positioned only 2 bp upstream of yidC, likely containing an internal promoter for yidC expression .

What is known about YidD and its relationship to YidC function?

YidD is a small protein encoded by the yidD gene that precedes yidC in the conserved gene cluster. Research has shown that:

  • YidD is expressed in E. coli and localizes to the inner membrane, likely through an amphipathic α-helix in its N-terminal region .

  • While YidD is not essential for bacterial growth and viability, its inactivation affects the insertion and processing of YidC-dependent inner membrane proteins. Compared to control cells, ΔyidD cells show altered processing of three YidC-dependent membrane proteins .

  • In vitro cross-linking studies have demonstrated that YidD is in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon, suggesting a direct role for YidD in membrane protein biogenesis .

These findings indicate YidD may serve as an accessory factor that enhances YidC-mediated membrane protein insertion efficiency.

What types of membrane proteins specifically require YidC for insertion?

YidC substrates can be categorized into three main groups:

Substrate TypeExamplesInsertion Mechanism
YidC-only pathway substratesM13 and Pf3 phage coat proteins, F₁F₀ ATPase subunits a and c, NADH dehydrogenase complex subunit KYidC alone is sufficient for complete insertion and assembly
Sec-YidC cooperative substratesCyoA (cytochrome bo₃ oxidase subunit II)YidC inserts N-terminal domain, Sec required for C-terminal domain translocation
Sec-dependent with YidC assistanceLep, FtsQ, MtlAYidC facilitates but is not essential; depletion only slightly affects insertion

This substrate specificity highlights YidC's versatility in membrane protein biogenesis, accommodating various protein structures and topologies .

What structural models of YidC have been developed and what methodologies were employed?

Structural models of YidC have been developed using a combination of computational and experimental approaches. One significant methodology employs evolutionary co-variation analysis to predict contacts between pairs of residues . The process involves:

  • Construction of multiple sequence alignments of YidC homologs (excluding non-conserved regions like the first transmembrane helix and P1 domain in E. coli YidC)

  • Computation of direct evolutionary couplings between pairs of residues to generate a matrix of coupling strengths

  • Analysis of diagonal and anti-diagonal patterns in the coupling matrix to identify parallel or anti-parallel helix-helix pairs

  • Calculation of probabilities for each possible helix-helix contact by aggregating evidence of stronger coupling coefficients

  • Positioning of transmembrane helices relative to each other using predicted contacts as constraints and rotating them according to their predicted lipid or protein exposure

  • Use of molecular modeling software (such as MODELLER) to create full-length models based on the transmembrane core, secondary structure prediction, and the highest coupling coefficients

The resulting structural model shows that the conserved membrane-integrated core of YidC forms a helical bundle arranged like the vertices of a pentagon, in the order 4-5-3-2-6 . This model provides crucial insights into how YidC might interact with substrate proteins during the insertion process.

What experimental approaches are used to study YidC-dependent protein insertion?

Several experimental approaches have been employed to study YidC-dependent protein insertion:

  • Genetic manipulation techniques:

    • Gene deletion or inactivation (e.g., construction of ΔyidD strains using methods like those developed by Datsenko and Wanner)

    • Verification of gene inactivation by PCR analysis

  • Biochemical and molecular biology techniques:

    • Preparation of inner membrane vesicles (IMVs) from bacterial strains

    • In vitro translation and insertion assays to monitor protein integration into membranes

    • Cross-linking studies to identify interaction partners during insertion

    • Protein localization studies using cellular fractionation

  • Structural analysis methods:

    • Computational evolutionary coupling analysis

    • Lipid-versus-protein-exposure predictions

    • Molecular dynamics simulations to refine structural models

  • Functional assays:

    • Monitoring insertion and processing of model YidC-dependent proteins in various genetic backgrounds

    • Comparing wild-type and mutant cells to assess the impact of genetic modifications on insertion efficiency

These approaches provide complementary information about YidC function, from structural details to in vivo significance.

How can researchers distinguish between YidC substrates that require the Sec translocon and those that don't?

Distinguishing between YidC-only substrates and those requiring Sec cooperation involves several methodological approaches:

  • Selective depletion studies: By separately depleting YidC or SecY components and monitoring the insertion of specific membrane proteins, researchers can determine dependency on each pathway. Proteins affected only by YidC depletion are likely YidC-only substrates, while those affected by both YidC and SecY depletion may require both systems .

  • In vitro reconstitution experiments: Purified components of the insertion machinery (YidC alone or YidC with SecYEG) can be reconstituted into liposomes. Testing the insertion of candidate proteins into these defined systems helps determine pathway requirements .

  • Cross-linking analysis: Site-specific cross-linking of nascent chains during membrane insertion can identify which translocon components interact with specific regions of the inserting protein. This approach has been used to show YidC association with transmembrane segments upon their lateral exit from the Sec translocon for proteins like Lep, FtsQ, and MtlA .

  • Domain-specific insertion analysis: For complex proteins potentially using both pathways (like CyoA), domain-specific analysis can determine which regions require which machinery. Studies have shown that YidC catalyzes insertion of CyoA's N-terminal domain while Sec is required for C-terminal domain translocation .

What factors should be considered when expressing and purifying recombinant YidC from S. saprophyticus?

While the search results don't specifically address recombinant S. saprophyticus YidC, several considerations can be extrapolated from E. coli YidC research:

  • Expression system selection: Choose between homologous (Staphylococcal) or heterologous (E. coli) expression systems, considering potential differences in membrane composition and protein folding machinery.

  • Membrane protein solubilization: Optimize detergent selection for efficient extraction from membranes while maintaining structural integrity and function.

  • Functional verification: Develop assays to confirm that purified recombinant YidC retains its insertase activity, potentially using known YidC substrates.

  • Structural considerations: Account for species-specific structural features that might impact folding, stability, or function when designing expression constructs.

  • Domain organization: Consider whether to include all domains or focus on the conserved core, as structural studies of E. coli YidC have excluded the non-conserved first transmembrane helix (TM1) and the P1 domain .

  • Interaction partners: Determine whether co-expression with YidD or other potential interaction partners might enhance stability or activity, given the demonstrated role of YidD in YidC-dependent protein insertion .

How can researchers effectively study YidC-YidD interactions in membrane protein insertion?

Based on the available research, several approaches can be employed to study YidC-YidD interactions:

  • Co-purification studies: Develop tagged versions of YidC and YidD to investigate whether they form stable complexes that can be co-purified from membranes.

  • Cross-linking analysis: Utilize in vitro cross-linking techniques similar to those that demonstrated YidD's proximity to nascent inner membrane proteins during localization in the Sec-YidC translocon .

  • Comparative insertion assays: Compare membrane protein insertion efficiency in wild-type cells, ΔyidD cells, YidC-depleted cells, and double-deficient strains to understand the individual and combined contributions of these proteins.

  • Structural analysis: Apply techniques like evolutionary coupling analysis to predict potential interaction surfaces between YidC and YidD, then validate these predictions through targeted mutagenesis .

  • Fluorescence-based interaction studies: Employ techniques like FRET (Förster Resonance Energy Transfer) with fluorescently labeled YidC and YidD to monitor their interactions in real-time during membrane protein insertion.

What approaches can be used to identify novel YidC substrates in S. saprophyticus?

To identify novel YidC substrates in S. saprophyticus, researchers could employ the following strategies:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.