Recombinant Staphylococcus saprophyticus subsp. saprophyticus Na (+)/H (+) antiporter subunit B1 (mnhB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
mnhB1; SSP1824; Na(+/H(+ antiporter subunit B1; Mnh complex subunit B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
mnhB1
Target Protein Sequence
MNRQKNNLIFQYSAVVIFFLIVMFGLSLFLAGHYTPGGGFVGGLLLSSALVIITVAFDIK TMRKIFPWDFKILIGIGLLFCLATPMASWFYNKNFFTHTPFEIPLGILPPMEMHTATFFD LGVMCAVVGTVMTIILSIGENE
Uniprot No.

Target Background

Function

The Mnh complex is a Na+/H+ antiporter involved in sodium ion excretion.

Database Links

KEGG: ssp:SSP1824

STRING: 342451.SSP1824

Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the mnhB1 subunit differ from other components of the Mnh antiporter system?

While specific data on S. saprophyticus mnhB1 is limited in the current literature, research on homologous systems in S. aureus indicates that different subunits within the Mnh antiporter complex have distinct roles. The MnhB1 subunit is likely involved in the structural assembly and stabilization of the antiporter complex. In S. aureus, the Mnh1 and Mnh2 antiporter systems have been shown to have different cation specificities and pH dependencies, with Mnh1 primarily exhibiting Na⁺/H⁺ exchange at pH 7.5, while Mnh2 demonstrates both Na⁺/H⁺ and K⁺/H⁺ exchange activities, especially at higher pH levels around 8.5 .

What genomic features characterize the mnhB1 gene in S. saprophyticus?

The mnhB1 gene in S. saprophyticus is part of the bacterial genome that codes for membrane transport proteins. While specific genomic data on mnhB1 in S. saprophyticus is not extensively documented in the provided sources, comparative genomic approaches similar to those used in other S. saprophyticus studies could identify its genomic context. Analyses of the S. saprophyticus core genome, which consists of approximately 1,646 conserved genes across strains, would likely include this essential membrane transport component . The gene would be expected to show conservation across S. saprophyticus strains if it plays a fundamental role in pH homeostasis and stress response.

What expression systems are optimal for producing recombinant S. saprophyticus mnhB1 protein?

For expression of recombinant S. saprophyticus mnhB1, E. coli expression systems are commonly employed for staphylococcal membrane proteins. Similar to approaches used for studying S. aureus antiporters, the antiporter-deficient KNabc E. coli strain could serve as an effective expression host for functional studies . When designing expression constructs, codon optimization is crucial for heterologous expression. In silico validation methods can predict expression efficiency - an ideal construct should achieve a codon adaptation index (CAI) close to 1.0 with optimal GC content around 45-50% to ensure efficient expression in E. coli .

How can researchers effectively assess the catalytic activity of recombinant mnhB1 in experimental settings?

The catalytic activity of recombinant mnhB1 as part of the complete antiporter complex can be measured using everted (inside-out) membrane vesicles, as demonstrated in studies of S. aureus Mnh antiporters. This experimental approach involves:

  • Preparation of everted membrane vesicles from E. coli expressing the recombinant antiporter

  • Measurement of cation/proton exchange by monitoring changes in fluorescence of pH-sensitive probes

  • Testing exchange activity with different cations (Na⁺, K⁺) at various pH values (7.0-9.5)

  • Quantification of exchange rates under different ionic conditions

These measurements should be performed across a pH range (7.0-9.5) to determine optimal pH for activity and substrate specificity profiles (Na⁺/H⁺ vs. K⁺/H⁺ exchange activities) .

What techniques can be used to characterize the structural properties of mnhB1?

To characterize the structural properties of mnhB1, researchers can employ:

  • Secondary structure prediction using computational tools like SOPMA to estimate the proportions of alpha helices, extended strands, random coils, and beta turns

  • Circular dichroism (CD) spectroscopy to experimentally verify secondary structure elements

  • Site-directed mutagenesis of conserved residues to identify functionally important domains

  • Cross-linking studies to determine subunit interactions within the antiporter complex

  • Proteoliposome reconstitution to study the protein in a defined membrane environment

For membrane proteins like mnhB1, techniques such as cryo-electron microscopy may be particularly valuable for structural characterization when combined with computational prediction methods.

How does mnhB1 contribute to pH homeostasis in S. saprophyticus?

Based on analogous systems in S. aureus, the Na (+)/H (+) antiporter containing mnhB1 likely contributes to pH homeostasis in S. saprophyticus by mediating the exchange of cytoplasmic protons for extracellular sodium ions. This exchange mechanism helps maintain internal pH within physiological ranges during alkaline stress conditions. In S. aureus, deletion of antiporter genes resulted in significant growth impairment at elevated pH (7.5-9.5), suggesting these systems are crucial for survival in alkaline environments . For researchers studying mnhB1 specifically, growth assays comparing wild-type and mnhB1 deletion mutants across pH gradients (pH 7.0-9.5) would help establish its specific contribution to pH regulation in S. saprophyticus.

What role does the mnhB1 play in S. saprophyticus halotolerance?

The mnhB1 subunit likely contributes to halotolerance (salt tolerance) in S. saprophyticus, similar to observations in S. aureus where Mnh antiporters are essential for growth under elevated sodium conditions. In S. aureus, the Mnh1 antiporter primarily contributes to halotolerance at neutral pH (7.5), while Mnh2 functions across a broader pH range (7.5-9.5) . To determine the specific contribution of mnhB1 to halotolerance in S. saprophyticus, researchers should:

  • Create gene deletion mutants (ΔmnhB1)

  • Assess growth rates in media with increasing NaCl concentrations (0.1-2.5M)

  • Compare growth kinetics at different pH values to determine pH-dependency of halotolerance

  • Complement the deletion with the wild-type gene to confirm phenotype specificity

These experiments would establish whether mnhB1 in S. saprophyticus functions primarily in halotolerance, osmotolerance, or both.

How does mnhB1 function potentially impact S. saprophyticus virulence in urinary tract infections?

The potential impact of mnhB1 on S. saprophyticus virulence in UTIs can be investigated by examining its role in stress adaptation during infection. In S. aureus, deletion of the mnhA1 gene (part of the Mnh1 antiporter system) led to significant reduction in virulence in a mouse infection model, while deletion of components of the Mnh2 system had minimal impact on virulence . For S. saprophyticus, which is primarily a uropathogen, the mnhB1 function may be particularly relevant for adaptation to the urinary tract environment, which features varying pH and osmolarity conditions.

To investigate this relationship, researchers should consider:

  • Comparing the virulence of wild-type and ΔmnhB1 mutants in appropriate UTI models

  • Assessing bacterial survival in synthetic urine with varying pH and salt concentrations

  • Evaluating adherence to uroepithelial cells, which is a key virulence trait for S. saprophyticus

  • Examining the relationship between antiporter function and biofilm formation, as 91% of S. saprophyticus isolates produce biofilms that contribute to pathogenesis

Is there a correlation between mnhB1 function and antimicrobial resistance in S. saprophyticus?

The potential correlation between mnhB1 function and antimicrobial resistance in S. saprophyticus represents an important research question. Studies on S. saprophyticus have identified that 14.91% of isolates demonstrate multidrug resistance . While direct evidence linking Na (+)/H (+) antiporters to antimicrobial resistance in S. saprophyticus is not explicitly documented in the available literature, membrane transport systems often contribute to antimicrobial tolerance through:

  • Maintenance of proton motive force, which affects drug uptake

  • Regulation of intracellular pH, which can influence antibiotic activity

  • Contribution to general stress responses that enhance survival during antibiotic exposure

To investigate potential correlations, researchers should:

  • Compare antimicrobial susceptibility profiles between wild-type and ΔmnhB1 mutants

  • Assess expression levels of mnhB1 following exposure to various antibiotics

  • Examine synergistic effects between antiporter inhibitors and conventional antibiotics

  • Investigate whether mnhB1 variants correlate with resistance patterns in clinical isolates

How does S. saprophyticus mnhB1 compare structurally and functionally to homologous proteins in other staphylococcal species?

Comparing S. saprophyticus mnhB1 with homologs in other staphylococcal species requires both sequence analysis and functional characterization. While specific comparative data for mnhB1 across species is limited in the provided sources, researchers can employ several approaches:

  • Sequence alignment analysis to identify conserved domains and species-specific variations

  • Phylogenetic analysis to determine evolutionary relationships

  • Heterologous expression of mnhB1 from different species in a common host for functional comparison

  • Cross-complementation studies to test functional interchangeability

The available data indicates that S. epidermidis contains a homologous Na (+)/H (+) antiporter subunit B1 (mnhB1) , suggesting conservation of this system across staphylococcal species. In S. aureus, two distinct antiporter systems (Mnh1 and Mnh2) have been characterized with different cation specificities and pH dependencies , which raises the question of whether S. saprophyticus possesses multiple antiporter systems with distinct properties.

What methods are most effective for performing cross-species comparative analyses of antiporter systems?

For effective cross-species comparative analyses of antiporter systems, researchers should employ:

  • Genomic analysis:

    • Whole genome sequencing and comparative genomics approaches as used in S. saprophyticus studies

    • Identification of conserved gene clusters and synteny analysis

    • Assessment of genetic context and regulatory elements

  • Functional characterization:

    • Expression of antiporter systems from different species in a common antiporter-deficient host

    • Standardized assays for measuring cation/proton exchange activities

    • Growth complementation studies under defined stress conditions

  • Structural modeling:

    • Homology modeling based on known structures

    • Identification of conserved functional domains across species

    • Prediction of species-specific structural adaptations

  • Evolutionary analysis:

    • Construction of phylogenetic trees based on antiporter gene sequences

    • Analysis of selection pressures on different antiporter components

    • Identification of horizontal gene transfer events

How can researchers effectively design gene deletion and complementation strategies for studying mnhB1 function?

Designing effective gene deletion and complementation strategies for studying mnhB1 function requires careful consideration of genetic context and potential polar effects on operon expression. Advanced researchers should:

  • Design precise deletion constructs:

    • Use allelic replacement approaches to create markerless, in-frame deletions

    • Consider potential polar effects on downstream genes if mnhB1 is part of an operon

    • Validate deletions using both PCR and sequencing approaches

    • Confirm absence of the target protein using immunoblotting if antibodies are available

  • Develop controlled complementation systems:

    • Create complementation constructs with native promoters for physiological expression levels

    • Consider inducible expression systems to control complementation levels

    • Validate complementation by measuring protein expression levels

    • Include epitope tags for protein detection while ensuring tags don't interfere with function

  • Assess phenotypic restoration:

    • Compare growth kinetics of wild-type, deletion, and complemented strains

    • Test stress responses across varied environmental conditions (pH, salt concentration)

    • Measure antiporter activity using biochemical assays

    • Evaluate virulence-associated phenotypes in appropriate models

What are the challenges in discerning the specific contribution of mnhB1 within multisubunit antiporter complexes?

Discerning the specific contribution of mnhB1 within multisubunit antiporter complexes presents several challenges:

  • Functional redundancy:

    • S. saprophyticus likely possesses multiple cation/proton antiporters with overlapping functions

    • Complete loss of function may require deletion of multiple systems, as seen in S. aureus where mnhA1 and mnhA2 double deletion showed more severe phenotypes than single deletions

  • Subunit interdependence:

    • Individual subunits may be non-functional when expressed alone

    • Assembly of the complete complex may be required for proper folding and function

    • Deletion of one subunit may destabilize the entire complex

  • Methodological approaches to address these challenges:

    • Site-directed mutagenesis of conserved residues rather than complete gene deletion

    • Expression of chimeric antiporter complexes with subunits from different systems

    • Conditional expression systems to titrate levels of individual subunits

    • Protein-protein interaction studies to map subunit dependencies

How can researchers integrate structural biology approaches with functional studies of mnhB1?

Integrating structural biology with functional studies of mnhB1 represents an advanced research approach. Researchers should consider:

  • Structural determination methods suitable for membrane proteins:

    • Cryo-electron microscopy for intact antiporter complexes

    • X-ray crystallography for soluble domains or stabilized protein variants

    • NMR spectroscopy for dynamic regions or smaller subunits

  • Structure-guided functional studies:

    • Identification of conserved residues for targeted mutagenesis

    • Generation of structure-based hypotheses about cation binding sites

    • Computational modeling of proton/cation exchange mechanisms

  • Integrative approaches:

    • Correlation of structural changes with functional readouts

    • Use of conformation-specific antibodies to trap functional states

    • Computational simulation of conformational changes during transport cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.