Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SSP1319; Probable CtpA-like serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
SSP1319
Target Protein Sequence
MSESKDTTEVNQEVNEKASSQSTKKQINFKRSHFIIILIVTILVTAMIAVFATIGISHWT SGLNSDQRDEMKKVEQVYQTLDDEYYKDTSSEELGTAAIDGMVKKLDDPYSDYMTKKETK SFNEDVSGDFVGIGAEMQKKGNQIQITSPMKQSPAEKAGIQPKDVVTKVNGKSIKGQPLE AIVKKVRGKQGTKVTLTIERGGQAHDITIKRDKIHVKSVEYQKHGDVGVFTINKFQNSTS GELKSAIIKAHKDGIRKIVLDLRNNPGGLLDEAVKMANIFIDKNETVVQLEKGKHKEAIK ASNDASKEAKDMDVSILVNKGSASASEVFTGAMKDYNKAKVYGSKTFGKGIVQTTREFED GSLLKFTNMKWLTPKSHYIHGKGITPDKKIEEPAYQSLNVIPSNKTYQLGDDDKNVKTMK VGLNVLGYHINNHSTEFDSELEDALKSFQKKNNLDVNGTFNKSTNEKFTQQLVEKANKED TVLNELLKKLN
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP1319

STRING: 342451.SSP1319

Protein Families
Peptidase S41A family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of the SSP1319 CtpA-like serine protease from S. saprophyticus?

The SSP1319 serine protease from S. saprophyticus shares structural similarities with other bacterial carboxyl-terminal processing proteases (CTPs). Based on comparative analysis with the well-characterized CtpA from Pseudomonas aeruginosa, these proteases typically assemble into multimeric structures. The P. aeruginosa CtpA, for instance, forms an inactive hexamer comprising a trimer of dimers .

To determine the precise structure of SSP1319:

  • Express the recombinant protein using vectors containing N-terminal fusion tags (His, GST, MBP, etc.)

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Perform X-ray crystallography or cryo-electron microscopy

  • Analyze the resulting structure for active site configuration and oligomeric state

Unlike other CTPs that may contain PDZ domains for substrate recognition and regulation, researchers should specifically analyze whether SSP1319 contains similar regulatory domains that influence its protease activity and substrate specificity.

What expression systems are most effective for producing recombinant SSP1319 protease?

For optimal expression of recombinant SSP1319, E. coli-based expression systems have proven effective for bacterial proteases. The following methodological approach is recommended:

  • Vector selection: Use vectors containing various solubility-enhancing fusion tags:

    • pMBP (maltose-binding protein tag)

    • pGST (glutathione S-transferase tag)

    • pDsbA (disulfide bond isomerase A tag)

    • His-tag vectors for IMAC purification

  • Expression conditions optimization:

    • Test BL21(DE3)pLysS strain to minimize toxicity and leaky expression

    • Implement glucose control of the lac repressor for tight regulation

    • Optimize induction temperature (16-37°C) and IPTG concentration (0.1-1.0 mM)

    • Extend expression time (4-24 hours) at lower temperatures for improved folding

  • Purification strategy:

    • For His-tagged constructs: Ni-NTA affinity chromatography

    • For GST-fusion proteins: Glutathione agarose resin

    • Include TEV protease cleavage site for tag removal if needed

Typical yields using batch purification with 2 mL 96-well filter blocks range between 2-200 μg of recombinant protein with 80-95% purity, sufficient for initial characterization studies .

How do I confirm the identity and purity of recombinant SSP1319?

Confirming identity and purity of recombinant SSP1319 requires a multi-step validation approach:

  • SDS-PAGE analysis: Run purified protein on Nu-PAGE gel to assess purity and expected molecular weight. Purity typically ranges from 80-95% depending on expression levels and purification efficiency .

  • Protein identification:

    • Perform in-gel trypsin digestion of the protein band

    • Analyze resulting peptides by MALDI-TOF/TOF mass spectrometry

    • Compare peptide fingerprint against theoretical tryptic digest of SSP1319

  • Western blotting: Use anti-His tag antibodies (if His-tagged) or specific antibodies against SSP1319 if available.

  • Activity assay: Confirm proteolytic activity using appropriate substrates to verify functional folding.

  • Proteomic analysis workflow:

    StepMethodExpected Outcome
    1SDS-PAGESingle band at expected MW
    2Tryptic digestPeptide fragments
    3MS analysis>80% sequence coverage
    4Database searchPositive SSP1319 identification
    5Activity testDetectable substrate cleavage

For absolute verification, N-terminal sequencing can be performed to confirm the correct start of the protein sequence, especially important if signal peptide processing is involved.

What are the optimal storage conditions for maintaining SSP1319 stability and activity?

To preserve the stability and activity of recombinant SSP1319, implement these evidence-based storage protocols:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in buffer containing stabilizing agents:

      • 20-50 mM HEPES or phosphate buffer, pH 7.4-8.0

      • 100-300 mM NaCl for ionic strength

      • 1-5 mM DTT to maintain reduced cysteine residues

      • 0.5-1 mM EDTA to chelate metal ions that could promote oxidation

  • Long-term storage:

    • Flash-freeze aliquots in liquid nitrogen

    • Store at -80°C to prevent freeze-thaw degradation

    • Add 10-20% glycerol as cryoprotectant

    • Use manual defrost freezer and avoid repeated freeze-thaw cycles

  • Activity preservation:

    • Consider including protease inhibitors (except serine protease inhibitors) to prevent degradation by contaminating proteases

    • For carrier-free preparations, BSA (0.1-1%) may be added as a stabilizer, unless it would interfere with downstream applications

  • Stability assessment:

    • Periodically test activity using established assays

    • Monitor by analytical SEC to detect aggregation

    • Verify retention of structure by circular dichroism

Studies with similar proteases indicate that purified recombinant proteins stored under optimal conditions typically retain >80% activity for at least 6 months at -80°C.

What role does SSP1319 play in S. saprophyticus biofilm formation and virulence?

The CtpA-like serine protease SSP1319 may significantly contribute to S. saprophyticus biofilm formation and pathogenicity, particularly in urinary tract infections:

  • Biofilm contribution hypothesis:
    Study results show that 91% of S. saprophyticus isolates (384/422) produce biofilms, with 91% of those (349/384) being strong biofilm producers . While direct evidence for SSP1319's role is still emerging, by analogy with other bacterial proteases:

    • It may process cell wall hydrolases like the LbcA-CtpA system in P. aeruginosa

    • Could regulate adhesion proteins involved in initial attachment

    • May modify extracellular matrix components for biofilm maturation

  • Lineage association:
    S. saprophyticus exists in two major clonal lineages (G and S), with different origins and potentially different virulence mechanisms . Research should determine if SSP1319 activity varies between these lineages, explaining differences in:

    • Biofilm matrix composition between clinical and environmental isolates

    • Protease expression levels in UTI versus commensal isolates

    • Substrate specificity variations between lineages

  • Experimental approaches:

    • Generate SSP1319 knockout mutants using CRISPR-Cas9

    • Compare biofilm formation between wild-type and mutant strains

    • Analyze biofilm composition using enzymatic detachment assays

    • Assess virulence in murine UTI models

    • Perform comparative proteomics to identify SSP1319 substrates

The matrix composition of S. saprophyticus biofilms differs between environmental and clinical isolates, suggesting that modulation of proteolytic activity could be a key step in pathogenicity transition .

How does SSP1319 compare to other bacterial carboxyl-terminal processing proteases (CTPs)?

SSP1319 belongs to the carboxyl-terminal processing protease family, but with distinct characteristics that differentiate it from other bacterial CTPs:

  • Structural comparison:
    Unlike some CTPs that contain PDZ domains for substrate recognition, analysis should determine if SSP1319 employs alternative mechanisms. P. aeruginosa CtpA forms a unique multimeric arrangement (hexamer composed of a trimer of dimers) , and research should investigate whether SSP1319 adopts similar oligomeric states.

  • Functional homology:

    CTP SourceOligomeric StateCo-factor RequirementSubstrate SpecificityVirulence Association
    P. aeruginosa CtpAHexamer (trimer of dimers)LbcA lipoproteinCell wall hydrolasesYes, T3SS defects
    S. saprophyticus SSP1319To be determinedUnknownUnknownPotential UTI role
    Other Staphylococci CTPsVariableVariableOften Ica-related proteinsBiofilm formation
  • Evolutionary relationships:
    Comparative genomic analysis reveals that some gene clusters, like ica, have been acquired by S. saprophyticus from other coagulase-negative staphylococci . Similarly, SSP1319 may have originated through horizontal gene transfer, potentially explaining differences in activity compared to homologs in other species.

  • Methodological investigation approach:

    • Perform phylogenetic analysis of SSP1319 against CTP homologs

    • Use site-directed mutagenesis to identify catalytic residues

    • Conduct substrate specificity profiling using peptide libraries

    • Test complementation with known CTPs from other bacteria

These analyses would contribute to understanding the unique evolutionary position of SSP1319 within the broader CTP family.

What is the substrate specificity of SSP1319 and how can it be determined experimentally?

Determining the substrate specificity of SSP1319 requires a multi-faceted experimental approach:

  • Peptide library screening:

    • Synthesize positional scanning combinatorial peptide libraries

    • Incubate libraries with purified SSP1319

    • Analyze cleavage products by HPLC and mass spectrometry

    • Generate position-specific scoring matrices for preferred residues

  • Candidate substrate testing:
    Based on knowledge of other CtpA-like proteases, potential substrates include:

    • Cell wall hydrolases (homologs of MepM, PA4404)

    • NlpC/P60 family peptidases (homologs of PA1198, PA1199)

    • Biofilm matrix proteins

    Test these candidates using:

    • In vitro cleavage assays with purified proteins

    • MS-based identification of cleavage sites

    • Co-expression studies in heterologous systems

  • Global proteome analysis:

    • Compare wild-type and SSP1319-knockout strains

    • Use SILAC or TMT labeling for quantitative proteomics

    • Identify proteins with altered abundance or processing

  • Structure-based prediction:
    By analogy with other serine proteases, active site mapping can inform substrate preference:

    • Determine crystal structure of SSP1319

    • Model substrate binding using docking simulations

    • Validate predictions through mutational analysis of binding pocket residues

  • Inhibitor development:
    Using approaches similar to those applied for other serine proteases, develop specific inhibitors based on peptide scaffolds like mupain-1 (CPAYSRYLDC) . Through structure-based rational design and substitution of key residues, create high-affinity, high-specificity inhibitors that can be used to probe SSP1319 function.

How does SSP1319 expression vary between clinical and environmental S. saprophyticus isolates?

Understanding the differential expression of SSP1319 between clinical and environmental isolates provides insights into its potential role in pathogenicity:

  • Expression analysis framework:

    • Collect diverse S. saprophyticus isolates from:

      • Clinical UTI samples

      • Human colonization (commensal)

      • Food-related environmental sources

    • Categorize by lineage (G or S) and biofilm production capacity

  • Transcriptomic approach:

    • Perform RNA-Seq under standardized growth conditions

    • Compare SSP1319 transcript levels across isolate sources

    • Identify co-regulated genes for functional context

    • Analyze promoter regions for regulatory differences

  • Protein expression quantification:

    • Develop specific antibodies against SSP1319

    • Perform Western blot analysis across isolate collection

    • Use quantitative proteomics (MRM-MS) for absolute quantification

    • Correlate expression levels with biofilm phenotypes

  • Regulatory mechanisms investigation:
    S. saprophyticus biofilm formation varies between clinical and environmental isolates . Exploring whether SSP1319 expression correlates with these differences:

    Isolate SourceBiofilm CharacteristicsExpected SSP1319 Expression
    Clinical UTIStrong (91% of isolates)Potentially elevated
    CommensalVariableBaseline/moderate
    EnvironmentalDistinct matrix compositionPotentially different isoforms
  • Functional correlation:

    • Test if SSP1319 expression levels correlate with:

      • Biofilm structure differences

      • Urinary tract epithelial cell adherence

      • Resistance to host immune factors

      • Antibiotic tolerance within biofilms

How can recombinant SSP1319 be used in developing anti-biofilm strategies against S. saprophyticus infections?

Leveraging recombinant SSP1319 for anti-biofilm therapeutic development presents several strategic research avenues:

  • Inhibitor development pathway:

    • Screen chemical libraries for specific SSP1319 inhibitors

    • Adapt peptide scaffold approaches (like mupain-1) for targeting SSP1319

    • Optimize lead compounds for:

      • Selectivity against bacterial vs. human proteases

      • Stability in urinary tract conditions

      • Bioavailability in urinary system

  • Vaccination strategy:

    • Evaluate recombinant SSP1319 (active site mutants) as vaccine candidates

    • Test if anti-SSP1319 antibodies can:

      • Neutralize protease activity

      • Reduce biofilm formation

      • Enhance opsonization and phagocytosis

      • Prevent bacterial colonization in animal models

  • Biofilm disruption approach:
    If SSP1319 is involved in biofilm matrix maintenance:

    • Test if exogenous addition of excess SSP1319 disrupts established biofilms

    • Design engineered SSP1319 variants with enhanced matrix-degrading activity

    • Evaluate synergy with conventional antibiotics

  • Diagnostic applications:

    • Develop SSP1319-specific detection assays for rapid UTI diagnosis

    • Create biosensors using SSP1319 substrates for point-of-care testing

    • Explore correlation between SSP1319 levels and infection severity

  • Combination therapy design:
    Research indicate that 91% of S. saprophyticus isolates produce biofilms, with most being strong producers . Given this prevalence, targeting SSP1319 in combination with:

    • Conventional antibiotics

    • Quorum sensing inhibitors

    • Other biofilm-disrupting enzymes (DNases, glycosidases)

could provide enhanced therapeutic efficacy against urinary tract infections caused by this pathogen.

What are the optimal assay conditions for measuring SSP1319 proteolytic activity?

Establishing robust assay conditions for SSP1319 activity requires systematic optimization:

  • Buffer system optimization:

    • Test multiple buffer systems (HEPES, Tris, Phosphate) at pH range 6.0-9.0

    • Optimize ionic strength (50-300 mM NaCl)

    • Evaluate divalent cation requirements (0-10 mM Ca²⁺, Mg²⁺, Zn²⁺)

    • Determine optimal reducing agent concentration (0-10 mM DTT)

  • Substrate selection:

    • Synthesize fluorogenic peptide substrates based on predicted cleavage sites

    • Test para-nitroanilide (pNA) or 7-amino-4-methylcoumarin (AMC) conjugated peptides

    • Develop FRET-based substrates for continuous monitoring

    • Adapt natural protein substrates with detection tags

  • Assay parameters:

    ParameterOptimization RangeReadout Method
    Temperature25-42°CActivity curve
    Enzyme concentration1-100 nMLinear response range
    Substrate concentration1-500 μMKinetic parameters (Km, kcat)
    Incubation time5-120 minTime course
    pH6.0-9.0pH optimum curve
  • Inhibitor profiling:

    • Test classical serine protease inhibitors (PMSF, AEBSF)

    • Evaluate specific peptide-based inhibitors

    • Determine IC₅₀ and inhibition mechanisms

    • Include positive controls for assay validation

  • Detection methods:

    • Fluorescence (Ex/Em appropriate for selected fluorophore)

    • Absorbance (405 nm for pNA substrates)

    • SDS-PAGE with densitometry for protein substrates

    • Mass spectrometry for precise cleavage site identification

Optimized assay conditions will provide a foundation for all subsequent studies of SSP1319 function, inhibitor screening, and comparative analysis with other proteases.

How can site-directed mutagenesis be used to identify the catalytic residues of SSP1319?

A systematic site-directed mutagenesis approach can effectively identify the catalytic mechanism and critical residues of SSP1319:

  • Predictive analysis:

    • Perform sequence alignment with characterized serine proteases

    • Use structural homology modeling based on known CTP structures

    • Identify candidate residues for the catalytic triad (typically Ser, His, Asp)

    • Predict substrate-binding pocket residues

  • Mutant library creation:

    • Generate alanine substitutions of predicted catalytic residues

    • Create conservative mutations (Ser→Thr, His→Asn, Asp→Glu) to verify function

    • Mutate substrate-binding pocket residues to alter specificity

    • Introduce mutations at potential regulatory sites

  • Expression and purification strategy:

    • Express wild-type and mutant proteins under identical conditions

    • Verify proper folding by circular dichroism

    • Ensure comparable purity by SDS-PAGE

    • Quantify protein concentration precisely

  • Activity assessment:

    • Measure kinetic parameters (kcat, Km) for each mutant

    • Determine relative activity compared to wild-type

    • Plot activity maps highlighting essential residues

    • Analyze substrate specificity changes in binding pocket mutants

  • Structural validation:

    • Obtain crystal structures of key mutants

    • Compare with wild-type structure

    • Analyze changes in active site geometry

    • Validate catalytic mechanism through structural insights

  • Experimental design table:

    Mutation TypeExpected OutcomeInterpretation
    Catalytic Ser→AlaComplete activity lossConfirms catalytic nucleophile
    Catalytic His→AlaSevere activity reductionConfirms general base
    Binding pocketAltered substrate specificityMaps substrate recognition
    Regulatory domainChanged activation propertiesIdentifies regulation mechanisms

This comprehensive mutagenesis approach will provide definitive evidence for the catalytic mechanism of SSP1319 and enable rational design of specific inhibitors.

What are the challenges and solutions for crystallizing SSP1319 for structural studies?

Crystallizing SSP1319 for high-resolution structural determination presents several challenges that can be addressed with systematic approaches:

  • Protein sample optimization:

    • Produce multiple constructs with different boundaries to remove flexible regions

    • Test various affinity tags (His, GST, MBP) and their positions (N or C-terminal)

    • Implement on-column tag cleavage for highest purity

    • Use size-exclusion chromatography as final purification step

    • Verify monodispersity by dynamic light scattering

  • Crystallization screening strategy:

    ApproachImplementationAdvantages
    Sparse matrix screensCommercial kits (Hampton, Molecular Dimensions)Covers diverse conditions
    Grid screensSystematic pH/precipitant variationsFine-tunes promising hits
    Additive screensSmall molecules, detergents, metalsImproves crystal quality
    SeedingMicroseed matrix seedingPromotes nucleation
    Surface entropy reductionEngineer mutations in surface residuesEnhances crystal contacts
  • Complex formation approaches:

    • Co-crystallize with specific inhibitors to stabilize active site

    • Use inactive mutants (Ser→Ala) with bound substrates

    • Generate antibody fragments (Fab) for co-crystallization

    • Test crystallization with natural binding partners

  • Alternative structural methods:

    • Cryo-electron microscopy for difficult-to-crystallize forms

    • Small-angle X-ray scattering (SAXS) for solution structure

    • NMR for dynamic regions and ligand binding

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes

  • Data collection and structure solution:

    • Use synchrotron radiation for high-resolution data

    • Implement selenomethionine labeling for phase determination

    • Apply molecular replacement using related CTP structures

    • Validate structure with Ramachandran analysis and MolProbity

By systematically addressing these challenges, researchers can obtain high-quality structural data for SSP1319, which is essential for understanding its mechanism and developing specific inhibitors.

How does SSP1319 contribute to antibiotic resistance in S. saprophyticus biofilms?

The role of SSP1319 in antibiotic resistance within S. saprophyticus biofilms represents an important area for investigation:

  • Biofilm-associated resistance mechanisms:
    S. saprophyticus shows strong biofilm formation capability (91% of isolates) , which may contribute to antibiotic tolerance through:

    • Physical barrier effects preventing antibiotic penetration

    • Metabolic heterogeneity creating persister cell populations

    • Altered gene expression in biofilm growth mode

    • Enzymatic inactivation of antibiotics within the biofilm matrix

  • SSP1319 potential contributions:

    • Modification of matrix proteins affecting permeability

    • Processing of resistance enzymes into active forms

    • Degradation of antimicrobial peptides

    • Alteration of cell surface proteins that are antibiotic targets

  • Experimental approaches:

    • Compare minimum biofilm eradication concentration (MBEC) between wild-type and SSP1319 knockout strains

    • Analyze biofilm architecture and antibiotic penetration using confocal microscopy with fluorescent antibiotics

    • Measure gene expression changes in response to antibiotic stress

    • Test combination therapies of SSP1319 inhibitors with conventional antibiotics

  • Clinical relevance assessment:

    • Determine if higher SSP1319 expression correlates with treatment failures

    • Investigate whether recurrent UTIs show altered SSP1319 activity

    • Compare antibiotic susceptibility profiles between planktonic and biofilm growth

    • Test if antibody neutralization of SSP1319 enhances antibiotic efficacy

Understanding these mechanisms could lead to novel therapeutic strategies combining conventional antibiotics with SSP1319 inhibitors to enhance treatment efficacy for biofilm-associated S. saprophyticus infections.

Can computational approaches predict potential inhibitors of SSP1319 for therapeutic development?

Computational approaches offer powerful strategies for identifying potential SSP1319 inhibitors:

  • Structure-based virtual screening:

    • Generate homology model of SSP1319 based on related CTPs

    • Perform molecular dynamics simulations to identify binding pocket flexibility

    • Screen virtual compound libraries (ZINC, ChEMBL) using docking algorithms

    • Score and rank compounds based on predicted binding energy

    • Select diverse top candidates for experimental validation

  • Peptide inhibitor design:
    Drawing from successful approaches with other serine proteases:

    • Adapt peptide scaffolds like mupain-1 (CPAYSRYLDC)

    • Perform in silico mutagenesis to optimize binding

    • Design cyclic peptides for enhanced stability

    • Predict protease-resistant modifications

  • Machine learning implementation:

    • Train models using known serine protease inhibitors

    • Identify pharmacophore features critical for activity

    • Use quantitative structure-activity relationship (QSAR) models

    • Implement deep learning for novel scaffold identification

  • Fragment-based approach:

    • Identify small molecule fragments that bind to different subsites

    • Link promising fragments to create high-affinity inhibitors

    • Optimize using free energy perturbation calculations

    • Evaluate drug-like properties (Lipinski's rules)

  • Workflow integration table:

    Computational StageMethodsOutput
    Target preparationHomology modeling, binding site analysisSSP1319 3D structure
    Library preparationFiltering by physicochemical propertiesCandidate compound database
    Virtual screeningMolecular docking, pharmacophore matchingRanked compound list
    Hit refinementMD simulations, binding free energy calculationOptimized lead compounds
    ADMET predictionMachine learning modelsPharmacokinetic profiles

This multi-faceted computational approach can significantly accelerate the discovery of SSP1319 inhibitors with potential therapeutic applications against S. saprophyticus infections.

What are the most promising future research directions for SSP1319?

The study of SSP1319 CtpA-like serine protease from S. saprophyticus presents several high-priority research directions:

  • Structure-function relationship exploration:

    • Determine high-resolution crystal structure

    • Map substrate binding sites and specificity determinants

    • Elucidate the catalytic mechanism in molecular detail

    • Compare with other bacterial CTPs to identify unique features

  • Role in pathogenesis clarification:

    • Define the contribution to biofilm formation in UTIs

    • Identify the complete set of natural substrates

    • Determine expression patterns during infection

    • Compare activity between clinical and environmental isolates

  • Therapeutic potential development:

    • Design specific inhibitors using structure-based approaches

    • Test inhibitors in infection models

    • Evaluate as vaccine candidate

    • Develop diagnostic applications based on activity

  • Evolutionary context understanding:

    • Analyze horizontal gene transfer patterns

    • Compare with homologs in other staphylococci

    • Determine if SSP1319 represents a virulence adaptation

    • Investigate potential co-evolution with substrates

  • Interdisciplinary integration:
    Combining multiple methodologies will yield the most comprehensive understanding:

    • Structural biology and biochemistry for mechanistic insights

    • Microbiology and molecular biology for functional relevance

    • Computational approaches for inhibitor design

    • Clinical microbiology for therapeutic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.