Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable elastin-binding protein ebpS (ebpS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ebpS; SSP1266; Probable elastin-binding protein EbpS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
ebpS
Target Protein Sequence
MSNNNFKDDFEKNRQSIDPKEHQENTQDSVNDSVDNIKEEVSDKSDEQFPPRNAQRRQRR RDTATNQREDEQSNQEHHNENNEVGDRDNGLQHEDNSSRDSNADKESNDPSQNNNLIHES SNNQQSENRHDINNEKDQSDKDSNNKKGAVIASSGAAGVGAYAASKHNDAASSSKDHNDK AHQQNQDWEQSNQTNDSTETQDENTNNHDSKKKGAAVAGGAAAAGAGAYAAGKHKGKKDK NDNEPEQNESKSDVKNEEKHGSKKKGAAVAGGAAAAGTGAAAASHSKSSTGNGGNGNGGN GGNGNNGDNNHDSEDNNKKKGGLLGKLLPIIAAILILAAIGIFGGMALTGNNDDKGSDDD KKVADNKDKDSDKAKDADSDKDSKSDKDKDKAKDDDNNQATTDSDSSDSSDNANSDSDQG NNDSQDQANSDQNQGTQDEQNSQNNQDQQSDQSQQNGQANSNQNGSSDQSQNASNDSNQQ NNQSSNSNSGQRTHVVNGQNLYRIAIQYYGEGTPENVEKIREANNIQGNDIHNGQRLVIP Q
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP1266

STRING: 342451.SSP1266

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural organization of EbpS in Staphylococcus saprophyticus?

EbpS in Staphylococcus species is characterized as an integral membrane protein with specific structural domains. Based on studies in S. aureus, EbpS comprises approximately 486 amino acid residues with an apparent molecular mass of 83 kDa when analyzed by Western blotting. The protein contains three hydrophobic domains: H1 (residues 205-224), H2 (residues 265-280), and H3 (residues 315-342). Experimental evidence using hybrid protein constructs with either alkaline phosphatase or β-galactosidase indicates that EbpS has two membrane-spanning domains (H1 and H3). The N-terminal region (residues 1-205) and C-terminal region (residues 343-486) are exposed on the outer face of the cytoplasmic membrane, with the functionally important ligand-binding domain located in the N-terminus between residues 14-34 .

How does the EbpS protein differ between S. saprophyticus and S. aureus?

While both S. saprophyticus and S. aureus express EbpS proteins that bind elastin, there are notable differences between them. In S. aureus, EbpS has been well-characterized as a 25-kDa surface protein that specifically interacts with elastin, playing a role in colonization and invasion of host tissues. S. aureus EbpS is encoded by a 606 base pair open reading frame producing a polypeptide with a predicted molecular mass of 23,345 daltons and pI of 4.9 . In S. saprophyticus, the ebpS gene is found in varying frequencies among different isolates, and its exact structural characteristics may differ. Unlike in S. aureus where EbpS is found exclusively in cytoplasmic membrane fractions, the localization and structural properties of S. saprophyticus EbpS may vary, contributing to differences in elastin binding and biofilm formation between these staphylococcal species .

What techniques are commonly used to express and purify recombinant EbpS?

Recombinant EbpS is typically expressed in E. coli expression systems following molecular cloning of the ebpS gene. The standard methodology involves:

  • PCR amplification of the ebpS gene from S. saprophyticus genomic DNA

  • Cloning into an appropriate expression vector with a fusion tag (commonly His-tag)

  • Transformation into E. coli strains optimized for protein expression (e.g., BL21(DE3))

  • Expression induction using IPTG or similar inducers

  • Cell lysis by sonication or mechanical disruption

  • Protein purification using affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

  • Further purification by size exclusion chromatography or ion exchange chromatography

For functional studies, researchers typically express either the full-length protein or specific domains, such as the N-terminal domain (residues 1-267) and C-terminal domain (residues 343-486). This approach allows for characterization of domain-specific functions and interactions .

How do biofilm formation capabilities differ between clinical and environmental isolates of S. saprophyticus, and what role does EbpS play in this difference?

Research on a large collection of S. saprophyticus isolates (n=422) revealed significant differences in biofilm formation between clinical and environmental isolates. While 91% of all isolates produced biofilms, the matrix composition varied considerably. Among representative strains (n=63), eight distinct biofilm matrix phenotypes were identified, with protein-based and protein-eDNA-polysaccharide (PDS) biofilms being the most common (38% each).

A notable pattern emerged showing that protein-based biofilms were predominantly associated with lineage S and clinical infection isolates (55% of infection isolates vs. 5% of environmental isolates, p<0.0001), while PDS-based biofilms were strongly linked to lineage G and environmental isolates (71% of environmental isolates vs. 21% of infection isolates, p<0.0001) .

What experimental approaches can be used to determine the functional domains of EbpS in S. saprophyticus?

To characterize the functional domains of EbpS in S. saprophyticus, researchers can employ several sophisticated experimental approaches:

  • Hybrid Protein Construction and Topology Mapping:

    • Create fusion proteins between EbpS fragments and reporter proteins (e.g., alkaline phosphatase, β-galactosidase)

    • Express these constructs in E. coli to determine membrane topology

    • Assess reporter enzyme activity to identify domains exposed on either side of the membrane

  • Site-Directed Mutagenesis:

    • Introduce specific mutations in predicted functional domains

    • Express mutant proteins and assess binding to elastin using solid-phase binding assays

    • Quantify changes in binding affinity to identify critical residues

  • Domain Deletion Analysis:

    • Generate recombinant EbpS variants lacking specific domains

    • Test binding capabilities using labeled tropoelastin

    • Compare binding affinities to wild-type EbpS

  • Cross-linking and Co-immunoprecipitation:

    • Use chemical cross-linkers to identify protein-protein interactions

    • Immunoprecipitate EbpS complexes to identify binding partners

    • Mass spectrometry analysis of isolated complexes

These approaches have been successfully employed in S. aureus, where researchers demonstrated that the N-terminal region (residues 14-34) contains the elastin-binding domain, and antibodies against this region inhibited elastin binding .

What are the optimal conditions for expressing functional recombinant EbpS from S. saprophyticus?

Optimizing expression of functional recombinant EbpS from S. saprophyticus requires careful consideration of several parameters:

  • Expression System Selection:

    • E. coli BL21(DE3) or its derivatives are commonly used for expression of staphylococcal membrane proteins

    • Consider using specialized strains for expression of potentially toxic membrane proteins (e.g., C41(DE3), C43(DE3))

  • Vector and Tag Selection:

    • pET series vectors with T7 promoter provide controlled, high-level expression

    • N-terminal tags are preferable as the C-terminus may contain important functional elements

    • His6-tag or MBP fusion tags can improve solubility and facilitate purification

  • Expression Conditions:

    • Lower temperature (16-25°C) often improves proper folding of membrane proteins

    • Induction with lower IPTG concentrations (0.1-0.5 mM) for longer periods (16-24 hours)

    • Growth in rich media (e.g., TB or 2xYT) for higher biomass

  • Membrane Protein Solubilization:

    • Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG)

    • Include stabilizing agents such as glycerol (10-20%) in purification buffers

    • Consider nanodiscs or liposome reconstitution for functional studies

Based on previous work with S. aureus EbpS, expression of specific domains rather than the full-length protein may improve yield and stability. The N-terminal domain (residues 1-267) containing the elastin-binding region and the C-terminal domain (residues 343-486) have been successfully expressed as recombinant proteins in E. coli .

How can researchers validate the specific interaction between recombinant EbpS and elastin?

Validating the specific interaction between recombinant EbpS and elastin requires multiple complementary approaches:

  • Solid-Phase Binding Assays:

    • Coat microplate wells with purified elastin or tropoelastin

    • Incubate with varying concentrations of purified recombinant EbpS

    • Detect bound EbpS using specific antibodies

    • Generate binding curves to determine affinity constants (Kd)

  • Competition Assays:

    • Determine specificity by competing labeled EbpS binding with unlabeled EbpS

    • Test competition with other matrix proteins to confirm specificity for elastin

  • Surface Plasmon Resonance (SPR):

    • Immobilize elastin on a sensor chip

    • Flow recombinant EbpS over the surface at different concentrations

    • Measure real-time binding kinetics (kon and koff rates)

    • Calculate affinity constants from kinetic data

  • Inhibition Studies:

    • Generate antibodies against recombinant EbpS

    • Test if these antibodies inhibit binding of S. saprophyticus to elastin

    • Likewise, test if recombinant EbpS inhibits binding of S. saprophyticus to elastin

  • Mutational Analysis:

    • Create point mutations in the predicted binding domain

    • Assess the impact on elastin binding

    • Map critical residues for the interaction

These approaches have been successfully employed in S. aureus, where polyclonal antibodies raised against recombinant EbpS interacted with native 25-kDa cell surface EbpS and inhibited staphylococcal elastin binding. Furthermore, recombinant EbpS bound specifically to immobilized elastin and inhibited binding of S. aureus to elastin .

What methods can be employed to study the role of EbpS in S. saprophyticus biofilm formation in vitro?

Investigating the role of EbpS in S. saprophyticus biofilm formation requires a systematic approach using various in vitro methods:

  • Generation of ebpS Knockout and Complementation Strains:

    • Create gene deletion mutants using allelic replacement techniques

    • Complement mutants with plasmid-encoded wild-type ebpS

    • Generate strains expressing mutated versions of EbpS

  • Quantitative Biofilm Assays:

    • Crystal violet staining in microtiter plates under static conditions

    • Flow cell systems for dynamic biofilm formation

    • Confocal laser scanning microscopy (CLSM) with fluorescent staining

    • Compare wild-type, mutant, and complemented strains

  • Biofilm Matrix Characterization:

    • Enzymatic detachment assays using proteinase K, DNase I, and sodium metaperiodate

    • Quantify matrix components (protein, eDNA, polysaccharides)

    • Determine matrix composition using biochemical assays and microscopy

  • Gene Expression Analysis:

    • RT-qPCR to measure ebpS expression during different stages of biofilm formation

    • RNA-Seq to identify genes co-regulated with ebpS during biofilm formation

    • Promoter-reporter fusions to visualize spatial and temporal expression patterns

  • Protein Localization Studies:

    • Immunofluorescence microscopy with anti-EbpS antibodies

    • Protein fractionation and Western blotting to determine subcellular localization

    • GFP fusion proteins to track EbpS localization in live cells

Research has shown that S. saprophyticus exhibits diverse biofilm matrix phenotypes, with protein-based biofilms being associated with lineage S and infection isolates. While ebpS is one of several putative biofilm-associated genes identified in S. saprophyticus, its specific contribution to different biofilm types requires further investigation .

How does the presence or absence of functional EbpS affect S. saprophyticus virulence in urinary tract infection models?

The role of EbpS in S. saprophyticus virulence, particularly in urinary tract infections (UTIs), can be investigated through several experimental approaches:

  • Animal Infection Models:

    • Murine UTI models comparing wild-type S. saprophyticus with ebpS knockout mutants

    • Transurethral inoculation followed by assessment of bacterial colonization and persistence

    • Histopathological examination of bladder and kidney tissues

    • Measurement of inflammatory markers and immune cell recruitment

  • Ex Vivo Adhesion Assays:

    • Adhesion to urinary tract epithelial cells (e.g., bladder epithelial cell line 5637)

    • Binding to extracellular matrix components present in urinary tract (including elastin)

    • Comparison between wild-type and ebpS mutant strains

  • In Vitro Virulence Factor Expression:

    • Analysis of how EbpS affects expression of other virulence factors

    • Assessment of biofilm formation in artificial urine medium

    • Evaluation of resistance to host defense mechanisms (complement, antimicrobial peptides)

  • Comparative Genomic and Transcriptomic Analysis:

    • Compare ebpS sequences and expression between highly virulent and less virulent strains

    • Identify genetic variants in ebpS associated with increased virulence

    • Analyze co-expression networks involving ebpS during infection

What is the relationship between EbpS expression and biofilm-associated antibiotic resistance in clinical isolates?

The relationship between EbpS expression and biofilm-associated antibiotic resistance in S. saprophyticus clinical isolates can be investigated through several methodological approaches:

  • Correlation Analysis in Clinical Isolates:

    • Quantify EbpS expression levels using RT-qPCR or Western blotting

    • Determine minimum inhibitory concentrations (MICs) and minimum biofilm eradication concentrations (MBECs)

    • Perform statistical analysis to identify correlations between EbpS expression and antibiotic resistance profiles

  • Biofilm Antibiotic Susceptibility Testing:

    • Compare antibiotic tolerance in biofilms formed by wild-type and ebpS mutant strains

    • Use the Calgary Biofilm Device or similar methods to determine MBECs

    • Test multiple antibiotic classes commonly used to treat UTIs

  • Molecular Mechanism Studies:

    • Investigate whether EbpS affects expression of efflux pumps or other resistance mechanisms

    • Analyze the impact of EbpS on biofilm matrix composition and antibiotic penetration

    • Examine potential interactions between EbpS and antibiotic targets

  • Combinatorial Treatment Approaches:

    • Test combinations of antibiotics with agents that target EbpS function

    • Evaluate anti-biofilm strategies in combination with conventional antibiotics

    • Assess efficacy against biofilms with different matrix compositions

Research has shown that S. saprophyticus isolates from different sources (clinical vs. environmental) produce biofilms with distinct matrix compositions. These differences in biofilm structure could potentially influence antibiotic penetration and efficacy, although the specific role of EbpS in this context has not been fully elucidated .

What advanced imaging techniques could be applied to visualize EbpS distribution and function in S. saprophyticus biofilms?

Several cutting-edge imaging techniques can be applied to visualize EbpS distribution and function in S. saprophyticus biofilms:

  • Super-Resolution Microscopy:

    • Structured illumination microscopy (SIM) for 3D visualization of EbpS distribution

    • Stochastic optical reconstruction microscopy (STORM) or photoactivated localization microscopy (PALM) for nanoscale resolution

    • Stimulated emission depletion (STED) microscopy for high-resolution imaging of protein localization

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence microscopy of labeled EbpS with electron microscopy

    • Provide both functional information and ultrastructural context

    • Visualize EbpS in relation to biofilm matrix components at nanometer resolution

  • Live-Cell Imaging Approaches:

    • Fluorescent protein fusions (e.g., EbpS-GFP) for real-time tracking

    • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility

    • Förster resonance energy transfer (FRET) to detect protein-protein interactions

  • Expansion Microscopy:

    • Physical expansion of biofilm samples to improve resolution

    • Combine with immunofluorescence to visualize EbpS and other biofilm components

    • Enable detailed mapping of protein distribution within complex biofilm structures

  • Cryo-Electron Tomography:

    • Visualize native structures at molecular resolution

    • Examine EbpS in its native membrane environment

    • Generate 3D reconstructions of protein complexes within biofilms

These advanced imaging techniques would provide unprecedented insights into how EbpS is spatially organized within biofilms of different matrix compositions, potentially revealing functional differences between biofilms formed by clinical versus environmental isolates .

How might comparative proteomic approaches advance our understanding of EbpS function in different S. saprophyticus lineages?

Comparative proteomic approaches offer powerful tools for elucidating EbpS function in different S. saprophyticus lineages:

  • Quantitative Proteomics:

    • Label-free quantification or isotope labeling (SILAC, iTRAQ) to compare protein abundance

    • Compare proteome profiles between lineages G and S, focusing on EbpS and interacting partners

    • Identify co-regulated proteins that may function with EbpS in different contexts

  • Protein-Protein Interaction Mapping:

    • Immunoprecipitation combined with mass spectrometry (IP-MS)

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to EbpS

    • Bacterial two-hybrid screening to identify direct interactors

  • Post-Translational Modification Analysis:

    • Phosphoproteomics to identify potential regulatory phosphorylation sites

    • Glycoproteomics to detect modifications that may affect function

    • Compare modification patterns between lineages and growth conditions

  • Structural Proteomics:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein dynamics

    • Cross-linking mass spectrometry (XL-MS) to identify spatial relationships

    • Native mass spectrometry to characterize protein complexes

  • Metaproteomics of Biofilms:

    • Analyze the entire protein content of biofilms formed by different lineages

    • Compare protein abundance and modifications in different biofilm matrix types

    • Identify lineage-specific protein signatures associated with particular biofilm phenotypes

These proteomic approaches would help uncover how EbpS function might differ between the two major S. saprophyticus lineages (G and S), potentially explaining the observed differences in biofilm matrix composition between clinical and environmental isolates .

What experimental controls are essential when studying recombinant EbpS function in heterologous expression systems?

When studying recombinant EbpS function in heterologous expression systems, several critical controls must be included:

  • Vector-Only Controls:

    • Cells transformed with empty expression vector

    • Controls for effects of vector backbone, promoter activity, and selection markers

    • Provides baseline for comparing effects of recombinant protein expression

  • Inactive Mutant Controls:

    • Express mutated versions of EbpS with alterations in key functional residues

    • Site-directed mutagenesis targeting the predicted elastin-binding domain

    • Controls for non-specific effects of protein overexpression

  • Domain Deletion Controls:

    • Express truncated versions lacking specific domains

    • Particularly important for distinguishing functions of N-terminal vs. C-terminal regions

    • Provides information on domain-specific activities

  • Related Protein Controls:

    • Express homologous proteins from other staphylococcal species

    • Particularly useful for comparative functional studies

    • Helps identify conserved vs. species-specific functions

  • Expression Level Verification:

    • Western blotting to confirm expression levels across all constructs

    • Quantitative analysis to ensure comparable expression levels

    • Controls for variation in expression that might confound functional assays

  • Localization Controls:

    • Verify proper subcellular localization of recombinant protein

    • Membrane fractionation to confirm integration into appropriate compartment

    • Controls for mislocalization artifacts that could affect function

In previous studies with S. aureus EbpS, researchers used specific antibodies against recombinant N-terminal (residues 1-267) and C-terminal (residues 343-486) domains to verify expression and localization, and validated function through elastin binding inhibition assays .

How can researchers design experiments to determine if the biofilm-promoting activity of EbpS is direct or indirect?

Determining whether EbpS directly or indirectly influences biofilm formation requires a carefully designed experimental approach:

  • Domain-Specific Functional Analysis:

    • Express and purify specific EbpS domains

    • Test each domain's ability to complement biofilm defects in ebpS mutants

    • Identify which domains are necessary and sufficient for biofilm promotion

  • Interaction Studies with Biofilm Matrix Components:

    • In vitro binding assays with purified EbpS and matrix components (proteins, polysaccharides, eDNA)

    • Surface plasmon resonance or other biophysical techniques to quantify interactions

    • Microscopy to visualize co-localization in biofilm structures

  • Transcriptional Profiling:

    • RNA-Seq comparing wild-type and ebpS mutants during biofilm formation

    • Identify differentially expressed genes involved in biofilm production

    • Test if EbpS acts as a regulator of other biofilm-associated genes

  • Temporal Expression Analysis:

    • Monitor ebpS expression during different stages of biofilm development

    • Determine if expression correlates with specific biofilm formation events

    • Use inducible expression systems to express EbpS at different biofilm stages

  • Structural Studies:

    • Identify potential structural motifs in EbpS that could mediate protein-protein interactions

    • Test if these motifs are required for biofilm promotion

    • Create targeted mutations that specifically disrupt these motifs

  • Comparative Analysis Across Strains:

    • Compare ebpS sequence and expression across strains with different biofilm phenotypes

    • Correlate specific EbpS variants with biofilm matrix composition

    • Perform allelic replacement to test if EbpS variants affect biofilm type

What statistical approaches are most appropriate for analyzing the relationship between EbpS sequence variations and biofilm phenotypes across S. saprophyticus isolates?

Analyzing relationships between EbpS sequence variations and biofilm phenotypes requires sophisticated statistical approaches:

  • Pangenome-Wide Association Studies (Pan-GWAS):

    • Identify statistical associations between genetic variants and biofilm phenotypes

    • Control for population structure and phylogenetic relationships

    • Use tools like Scoary, treeWAS, or bugwas specifically designed for bacterial GWAS

  • Multivariate Statistical Methods:

    • Principal Component Analysis (PCA) to reduce dimensionality of sequence variation data

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify variables most predictive of biofilm phenotypes

    • PERMANOVA to test for significant differences between groups

  • Machine Learning Classification:

    • Random Forests or Support Vector Machines to identify predictive sequence features

    • Cross-validation to assess model performance

    • Feature importance metrics to rank the contribution of specific variations

  • Phylogenetic Comparative Methods:

    • Account for shared evolutionary history using phylogenetic generalized linear models

    • Test for phylogenetic signal in biofilm phenotypes

    • Identify convergent evolution of similar biofilm phenotypes

  • Network-Based Approaches:

    • Construct gene co-occurrence networks to identify genes that cluster with ebpS variants

    • Identify modules of genes associated with specific biofilm phenotypes

    • Infer potential functional relationships based on network topology

These statistical methods have been successfully applied in the study of S. saprophyticus, where researchers used a pangenome-wide association study approach to identify factors associated with biofilm formation and structure variation across a large collection of isolates (n=422) .

How can researchers integrate genomic, transcriptomic, and phenotypic data to develop a comprehensive model of EbpS function in S. saprophyticus?

Developing a comprehensive model of EbpS function requires integration of multiple data types through sophisticated computational approaches:

  • Multi-omics Data Integration:

    • Combine genomic, transcriptomic, proteomic, and phenotypic datasets

    • Use methods such as Similarity Network Fusion (SNF) or Joint Non-negative Matrix Factorization (jNMF)

    • Identify patterns and relationships that may not be evident in single data types

  • Systems Biology Modeling:

    • Construct gene regulatory networks centered around ebpS

    • Use ordinary differential equation (ODE) models to simulate regulatory dynamics

    • Test hypotheses about EbpS function through in silico perturbations

  • Bayesian Network Analysis:

    • Infer causal relationships between genetic variants, gene expression, and phenotypes

    • Account for uncertainty in the data

    • Generate testable hypotheses about regulatory relationships

  • Pathway Enrichment Analysis:

    • Identify biological pathways enriched in genes co-regulated with ebpS

    • Compare pathway activity between different lineages and biofilm phenotypes

    • Contextualize EbpS function within cellular processes

  • Structural and Evolutionary Analysis:

    • Integrate protein structure predictions with sequence variation data

    • Map sequence variations to predicted functional domains

    • Analyze conservation patterns across staphylococcal species

  • Visualization Techniques:

    • Develop interactive visualizations that integrate multiple data types

    • Use dimensionality reduction techniques to visualize complex relationships

    • Create network visualizations to illustrate functional interactions

This integrated approach would build upon current understanding of S. saprophyticus biofilm diversity, where research has already established differences in biofilm matrix composition between clinical and environmental isolates, with protein-based biofilms predominantly associated with lineage S and infection isolates .

What are the main technical challenges in expressing and purifying functional recombinant EbpS, and how can they be overcome?

Expressing and purifying functional recombinant EbpS presents several technical challenges with specific solutions:

  • Challenge: Membrane Protein Solubility
    Solutions:

    • Express only soluble domains (e.g., N-terminal domain residues 1-205)

    • Use specialized detergents (DDM, LDAO) for membrane protein extraction

    • Employ fusion partners that enhance solubility (MBP, SUMO, Fh8)

    • Screen multiple expression constructs with varying domain boundaries

  • Challenge: Proper Folding
    Solutions:

    • Lower expression temperature (16-20°C) to slow folding and prevent aggregation

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Use specialized E. coli strains designed for membrane proteins (C41, C43)

    • Include stabilizing additives in buffers (glycerol, specific lipids)

  • Challenge: Low Expression Yields
    Solutions:

    • Optimize codon usage for E. coli expression

    • Use strong but tightly regulated promoters (T7 with lac operator)

    • Test different induction conditions (IPTG concentration, induction time)

    • Scale up culture volume with optimized conditions

  • Challenge: Protein Aggregation During Purification
    Solutions:

    • Include reducing agents (DTT, β-mercaptoethanol) to prevent disulfide-mediated aggregation

    • Use size exclusion chromatography to separate aggregates

    • Include stabilizing agents in all buffers (glycerol, arginine)

    • Perform purification at lower temperatures (4°C)

  • Challenge: Loss of Function During Purification
    Solutions:

    • Validate function at each purification step

    • Use milder elution conditions (gradient elution)

    • Include specific ligands or binding partners to stabilize active conformation

    • Consider membrane mimetics (nanodiscs, liposomes) for reconstitution

Previous studies with S. aureus EbpS successfully expressed and purified recombinant N-terminal (residues 1-267) and C-terminal domains (residues 343-486) in E. coli, demonstrating that domain-specific expression can overcome many of these challenges .

What are the limitations of current methods for studying S. saprophyticus biofilms, and how might these be addressed in future research?

Current methods for studying S. saprophyticus biofilms have several limitations that future research methodologies could address:

  • Limitation: Static Biofilm Models Lack Physiological Relevance
    Future Approaches:

    • Develop microfluidic systems that mimic urinary tract flow conditions

    • Establish ex vivo models using explanted urinary tract tissues

    • Design 3D-printed flow cells that recreate urinary tract geometry

    • Incorporate host factors (urine components, epithelial cells) into models

  • Limitation: Limited Resolution in Biofilm Structure Analysis
    Future Approaches:

    • Apply super-resolution microscopy techniques (STORM, STED)

    • Implement volumetric imaging methods with cleared biofilm samples

    • Use adaptive optics to improve imaging depth in thick biofilms

    • Combine with specific probes for matrix components

  • Limitation: Poor Correlation Between In Vitro and In Vivo Biofilms
    Future Approaches:

    • Develop animal models that better mimic human UTIs

    • Use intravital microscopy to visualize biofilm formation in vivo

    • Analyze ex vivo biofilms from explanted catheters or tissues

    • Validate findings from in vitro models in clinical samples

  • Limitation: Difficulty in Genetic Manipulation of Clinical Isolates
    Future Approaches:

    • Optimize transformation protocols specifically for S. saprophyticus

    • Develop CRISPR-Cas9 systems tailored for S. saprophyticus

    • Create shuttle vectors with S. saprophyticus-specific origins and promoters

    • Establish conditional gene expression systems for essential genes

  • Limitation: Incomplete Understanding of Matrix Component Interactions
    Future Approaches:

    • Develop selective labeling techniques for specific matrix components

    • Use correlative microscopy to link composition with structure

    • Apply rheological measurements to understand mechanical properties

    • Develop computational models of matrix component interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.