Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 2 (qoxA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
qoxA; SSP1730; Probable quinol oxidase subunit 2; Quinol oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-373
Protein Length
Full Length of Mature Protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
qoxA
Target Protein Sequence
CSNVEVLNPKGPMASDSKFLIMYSIIFMLVIIAAVLILFTVFLYKYRIGNTDESGKMHHN SLLETIWFIIPVIIVIALAIPTVNSLYNYEEKPQKEDDPLVVYATSAGYKWFFSYPEEKI ETVNHLTIPKDRPVVFKLQSMDMMTSFWIPQLGGQKYAMTGMTMDWTLTASEEGTFRGRN SNFNGEGFSRQTFDVNSVSQSKFEDWVKDAKKQKVLDQDTFDKQLLPTTENKNLTFSGTH LAFVDPAADPEYIFYAYDRYNFVQKDPNFNTEEERTADVLDKPDQPARKPEITNANYERH GMKAMILGNNEPYDSEFKDEESHNMDEMEKISEGAKDEKASKIEKKDHENGGGH
Uniprot No.

Target Background

Function

This protein catalyzes quinol oxidation coupled with the reduction of oxygen to water. Subunit II facilitates electron transfer from a quinol to the binuclear center within the catalytic subunit I.

Database Links

KEGG: ssp:SSP1730

STRING: 342451.SSP1730

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is quinol oxidase subunit 2 (qoxA) in Staphylococcus saprophyticus?

Quinol oxidase subunit 2 (qoxA) is a critical component of the terminal respiratory oxidase complex in Staphylococcus saprophyticus subsp. saprophyticus. It functions as part of the QoxABCD complex, which serves as a terminal oxidase in the electron transport chain of this organism. In Staphylococcus species, qoxA constitutes one of the four subunits (along with qoxB, qoxC, and qoxD) that form a functional menaquinol oxidase . This protein plays an essential role in aerobic respiration by facilitating electron transfer from menaquinol to molecular oxygen, thereby contributing to energy production through oxidative phosphorylation .

How does qoxA differ across Staphylococcus species?

While qoxA proteins maintain functional conservation across Staphylococcus species, there are notable structural and sequence variations. The qoxA protein from S. saprophyticus shares significant homology with its counterparts in S. aureus and S. epidermidis, yet displays species-specific amino acid sequences that may influence substrate binding affinity and interaction with other subunits . In S. aureus, qoxA is part of an aa3-type menaquinol oxidase complex, though it can also assemble as a bo3-type oxidase under certain conditions . These variations in terminal oxidase composition between species like S. saprophyticus, S. aureus, and S. epidermidis reflect adaptations to different ecological niches and metabolic requirements.

What is the relationship between qoxA and bacterial virulence?

The relationship between qoxA and bacterial virulence operates through the protein's central role in aerobic respiration. In S. aureus, a close relative of S. saprophyticus, the QoxABCD complex (containing qoxA) is one of two terminal oxidases that enable aerobic respiration and successful colonization of host tissues . For S. saprophyticus, a common urinary tract pathogen, functional qoxA contributes to virulence by supporting bacterial growth under the oxygen-variable conditions encountered during infection. The respiratory flexibility conferred by qoxA and its associated complex allows the bacterium to maintain energy production in different host microenvironments, supporting persistent infection and resistance to host defense mechanisms.

What is the relationship between qoxA and other components of the respiratory chain?

The qoxA protein functions within a sophisticated network of respiratory components in S. saprophyticus. The QoxABCD complex (which includes qoxA) serves as one of the terminal oxidases in a branched respiratory chain. Based on studies in related staphylococci, particularly S. aureus, we know that QoxABCD operates alongside an alternative terminal oxidase, CydAB . These oxidases provide respiratory flexibility, allowing bacteria to adapt to varying oxygen concentrations in different environments.

The functional relationship between qoxA and upstream components involves electron transfer from menaquinol to the oxidase complex. Research indicates that QoxABCD in S. aureus is specifically a menaquinol oxidase rather than a ubiquinol oxidase, which reflects the adaptation of staphylococci to use menaquinone as their primary quinone electron carrier . Furthermore, the QoxABCD complex containing qoxA requires a previously uncharacterized protein called CtaM for proper function, suggesting a complex network of protein-protein interactions in the respiratory chain of staphylococci .

How does heme incorporation affect qoxA functionality?

What role does CtaM play in qoxA function?

CtaM, a previously uncharacterized protein, has been identified as essential for proper QoxABCD function in S. aureus and potentially in other staphylococci including S. saprophyticus . This protein is encoded by a gene adjacent to ctaB in the genome (NWMN_0982 in S. aureus) and is conserved among aerobically respiring Firmicutes . The specific molecular mechanism through which CtaM supports qoxA function remains under investigation, but current evidence suggests it may play a role in the assembly or stability of the QoxABCD complex, particularly in relation to heme incorporation.

Studies in S. aureus have demonstrated that CtaM is required for the function of aa3-type menaquinol oxidase, placing it in a critical position within the staphylococcal respiratory chain . This discovery highlights the complexity of terminal oxidase function and suggests that proper qoxA activity depends not only on the core subunits of the oxidase complex but also on accessory proteins that may facilitate assembly, cofactor incorporation, or membrane integration.

What expression systems are optimal for producing recombinant qoxA?

Multiple expression systems have been validated for recombinant qoxA production, each with distinct advantages depending on research objectives. The most commonly employed hosts include:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliRapid growth, cost-effective, well-established protocolsMay require codon optimization, potential inclusion body formation2-5 mg/L culture
Yeast (S. cerevisiae, P. pastoris)Post-translational modifications, secretion capabilityLonger cultivation time, complex media requirements1-3 mg/L culture
Baculovirus/Insect cellsMammalian-like post-translational modificationsHigher cost, technical complexity3-8 mg/L culture
Mammalian cellsNative-like folding and modificationsHighest cost, lowest yield, longest production time0.5-2 mg/L culture
Cell-free expressionRapid production, amenable to toxic proteinsLimited scale, higher cost per unit protein0.1-1 mg/reaction

What purification strategies yield highest purity recombinant qoxA?

Effective purification of recombinant qoxA requires a multi-step approach that addresses the membrane-associated nature of this protein. The following protocol consistently achieves ≥85% purity as determined by SDS-PAGE :

  • Cell lysis and membrane isolation: Mechanical disruption (sonication or high-pressure homogenization) followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Gentle extraction using mild detergents (n-dodecyl-β-D-maltoside or digitonin) that maintain protein structure and activity.

  • Affinity chromatography: Utilizing His-tag or other fusion tags for initial capture, with careful optimization of imidazole concentration in wash buffers to minimize non-specific binding.

  • Size exclusion chromatography: Further purification based on molecular size, which also allows assessment of protein aggregation state.

  • Quality control: Purity assessment by SDS-PAGE, with successful preparations consistently achieving ≥85% purity .

For functional studies, maintaining the native conformation during purification is critical. Detergent selection and buffer composition must be optimized to preserve protein-protein interactions, particularly when studying qoxA in the context of the complete QoxABCD complex.

How can researchers assess qoxA functionality in vitro?

Assessment of qoxA functionality requires consideration of its role within the QoxABCD complex. Based on established protocols for terminal oxidases, the following methods provide comprehensive functional analysis:

  • Oxygen consumption assays: Polarographic measurements using oxygen electrodes (Clark-type) can quantify electron transfer activity when qoxA is reconstituted with other Qox subunits. Typical reaction mixtures contain appropriate quinol substrates (menaquinol for staphylococcal qoxA) and various electron donors.

  • Spectroscopic analysis: UV-visible spectroscopy can monitor heme reduction/oxidation status, providing insights into electron transfer efficiency. Absorption peaks at specific wavelengths indicate different heme types (a, b, o) and their redox states .

  • Reconstitution studies: Incorporation of purified qoxA into liposomes or nanodiscs with other Qox subunits allows assessment of proton-pumping activity and membrane potential generation.

  • Inhibitor sensitivity: Differential sensitivity to inhibitors such as KCN can distinguish between aa3-type and bo3-type oxidase activity, providing insights into the specific form of assembled QoxABCD complex .

When evaluating qoxA function, researchers should consider that functional assembly often requires all four Qox subunits (A, B, C, D) and potentially accessory factors like CtaM . Furthermore, the heme content significantly impacts functionality, with aa3-type and bo3-type variants showing distinct biochemical properties.

How do terminal oxidases from different Staphylococcus species compare?

Terminal oxidases across Staphylococcus species show both conservation and adaptation to specific ecological niches. The following table summarizes key comparative aspects:

SpeciesTerminal OxidasesHeme TypesNotable Features
S. saprophyticusQoxABCD, CydABa, a3, o, bPrimary urinary tract pathogen, adapted to urinary environment
S. aureusQoxABCD, CydABa, a3, o, bVersatile pathogen, QoxABCD can function with different heme types
S. epidermidisQoxABCD, CydABa, a3, o, bBiofilm former, skin commensal with opportunistic pathogenicity
B. subtilis (reference)QoxABCD, CydABa, a3, o, bSoil bacterium, widely studied model for Gram-positive respiration

While all these species possess both QoxABCD and CydAB terminal oxidases, functional analyses have revealed species-specific adaptations. In S. aureus, QoxABCD exhibits remarkable flexibility in heme utilization, functioning as either an aa3-type or bo3-type oxidase depending on heme availability . This adaptability likely extends to S. saprophyticus, though with potential modifications reflecting its adaptation to the urinary tract environment.

The comparative analysis of oxidase function across species provides valuable insights into respiratory chain evolution and adaptation. S. saprophyticus, with its specialized urinary tract niche, may have evolved distinct regulatory mechanisms for oxidase expression compared to the more versatile S. aureus.

What are the implications of qoxA research for understanding bacterial pathogenesis?

Research on qoxA and the QoxABCD complex has significant implications for understanding staphylococcal pathogenesis. In S. aureus, a related pathogen, the QoxABCD and CydAB terminal oxidases contribute to colonization of distinct host tissues . By extension, qoxA function in S. saprophyticus likely influences this organism's ability to colonize and persist in the urinary tract.

The respiratory flexibility conferred by having multiple terminal oxidases (QoxABCD and CydAB) allows staphylococci to adapt to varying oxygen concentrations encountered during infection. This adaptability is particularly relevant for S. saprophyticus, which must navigate the oxygen-variable environment of the urinary tract during pathogenesis.

Furthermore, the dependence of QoxABCD on the accessory protein CtaM opens new avenues for understanding bacterial respiration in host environments . The conservation of CtaM among aerobically respiring Firmicutes suggests a common mechanism for terminal oxidase function that could potentially be targeted for therapeutic intervention.

What emerging technologies show promise for qoxA research?

Several cutting-edge technologies are reshaping the landscape of qoxA research and respiratory chain studies:

  • Cryo-electron microscopy (Cryo-EM): This technique is revolutionizing structural biology by enabling visualization of membrane protein complexes like QoxABCD without crystallization. Recent advances in detector technology and image processing algorithms now allow near-atomic resolution of large membrane protein assemblies.

  • Single-molecule techniques: Approaches such as single-molecule FRET (Förster Resonance Energy Transfer) can provide unprecedented insights into conformational changes during the catalytic cycle of qoxA within the QoxABCD complex.

  • CRISPR-Cas9 genome editing: Precise genetic manipulation in staphylococci now allows systematic structure-function studies of qoxA through targeted mutations and domain swapping experiments.

  • Nanoscale respirometry: Emerging microfluidic devices capable of measuring oxygen consumption in small volumes enable high-throughput screening of conditions affecting qoxA function.

  • Synthetic biology approaches: Reconstitution of minimal respiratory chains in synthetic membrane systems provides controlled environments for dissecting qoxA function and interactions with other components.

These technologies will facilitate deeper understanding of qoxA structure-function relationships and its role in staphylococcal physiology and pathogenesis.

What are the critical unanswered questions regarding qoxA function?

Despite significant advances, several fundamental questions about qoxA remain unanswered:

  • Structural determinants of heme specificity: What structural features of qoxA determine its ability to function with different heme types (A, B, O) and how does heme composition affect catalytic efficiency?

  • CtaM interaction mechanism: How does CtaM interact with qoxA or the QoxABCD complex to support function? Does it act as an assembly factor, a stabilizing protein, or play a more direct role in catalysis?

  • Regulatory networks: What transcriptional and post-translational mechanisms regulate qoxA expression and function in response to environmental conditions such as oxygen availability and host factors?

  • Energy conservation efficiency: How does the proton-pumping efficiency of QoxABCD compare between aa3-type and bo3-type configurations, and what implications does this have for bacterial fitness in different environments?

  • Species-specific adaptations: How have the structural and functional properties of qoxA evolved in S. saprophyticus compared to other staphylococci, and do these differences contribute to niche adaptation?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational modeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.