Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 3 (qoxC)

Shipped with Ice Packs
In Stock

Description

Overview of QoxC

QoxC is a subunit of the quinol oxidase complex, a terminal oxidase in the electron transport chain of Staphylococcus saprophyticus. This enzyme plays a critical role in aerobic respiration by transferring electrons from menaquinol to molecular oxygen, generating a proton gradient for ATP synthesis. Recombinant QoxC refers to the protein produced via heterologous expression systems (e.g., E. coli or yeast) for functional and structural studies .

Genomic Context

  • The qoxC gene is part of the qoxABCD operon, which encodes four subunits of the quinol oxidase complex .

  • In S. saprophyticus, this operon is conserved in pathogenic lineages and linked to metabolic adaptability in diverse environments .

Protein Characteristics

FeatureDetail
Gene IDSSP_RS09115 (homolog in S. saprophyticus ATCC 15305)
Protein Length~300–400 amino acids (exact length varies by strain)
DomainsPredicted transmembrane helices; conserved heme-copper oxidase motifs
Post-Translational ModificationsNone reported in current datasets

Functional Role in Bacterial Physiology

QoxC contributes to:

  • Aerobic Respiration: Facilitates electron transfer during oxidative phosphorylation, critical for energy production under oxygen-rich conditions .

  • Pathogenesis: Terminal oxidases like QoxC enhance bacterial fitness during infection by supporting survival in host niches (e.g., urinary tract) .

  • Antimicrobial Resistance: Biofilm-associated S. saprophyticus exhibits increased tolerance to antibiotics, though direct links to QoxC remain under investigation .

Key Studies

  1. Role in Virulence

    • In S. aureus, deletion of qoxB (a homolog) reduced bacterial burden in murine infection models, suggesting Qox-family proteins are virulence factors .

    • S. saprophyticus lineages carrying intact qoxABCD operons show enhanced survival in metal-rich environments (e.g., urinary tract) .

  2. Metabolic Adaptations

    • Comparative genomics revealed that qoxC is enriched in clinical isolates, implicating it in host adaptation .

    • The operon’s expression is modulated by environmental stressors (e.g., hypoxia, heavy metals) .

  3. Recombinant Production

    • Recombinant QoxC has been expressed in E. coli with His-tags for purification, though structural studies remain limited .

    • Functional assays confirm its role in maintaining membrane potential during respiration .

Implications for Antimicrobial Development

  • Target Potential: The QoxABCD complex is absent in humans, making it a candidate for species-specific drug design .

  • Resistance Mechanisms: Biofilm-associated S. saprophyticus exhibits up to 32-fold increased MIC values for fluoroquinolones, though QoxC’s direct involvement requires validation .

Unresolved Questions and Future Directions

  • Structural Insights: No crystal structures of QoxC are available; resolving this could aid inhibitor design.

  • Regulatory Pathways: How qoxABCD expression is controlled in response to host environments remains unclear.

  • Interspecies Transfer: Evidence suggests horizontal gene transfer of respiratory genes among staphylococci, but mechanisms are undefined .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
qoxC; SSP1732; Probable quinol oxidase subunit 3; Quinol oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
qoxC
Target Protein Sequence
MSHDANTIDQRSHEGNLNKLGFWVFLTAEFSLFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLISSYTCGIAIYYMRKEKEKLMLIWMIITVLLGMVFVGFEIYEFAHYVHE GVNLTIGSYWSSFFILLGTHGAHVSLGIVWIICLLIQVAMRGLNKDNAPKLFIVSLYWHF LDVVWIFIFTAVYMIGMVFSG
Uniprot No.

Target Background

Function
Catalyzes the oxidation of quinol with the simultaneous reduction of oxygen to water.
Database Links

KEGG: ssp:SSP1732

STRING: 342451.SSP1732

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of quinol oxidase in Staphylococcus saprophyticus respiratory pathways?

Quinol oxidase functions as a terminal respiratory enzyme in S. saprophyticus, facilitating electron transfer from quinol to oxygen in the electron transport chain. This process is critical for aerobic respiration and energy production in these bacteria. Unlike cytochrome c oxidases, quinol oxidases have adapted to use quinol as their electron donor, which has significant implications for respiratory flexibility and energetic efficiency . The ability to use quinol directly allows S. saprophyticus to maintain respiration under varying environmental conditions, potentially contributing to its persistence in both clinical and environmental settings.

Where is qoxC positioned within the S. saprophyticus genome?

While the specific genomic location of qoxC in S. saprophyticus is not directly mentioned in the available data, comparative genomics approaches suggest that respiratory chain components in S. saprophyticus, like other staphylococci, typically exist in operonic structures. Similar to other staphylococcal species, the qox operon in S. saprophyticus likely contains multiple subunits (qoxABCD) arranged in a single transcriptional unit. Genomic analyses of various S. saprophyticus strains have revealed considerable variability in gene organization and acquisition patterns, as evidenced by the diverse arrangements of other gene clusters such as the ica operon .

What are the optimal conditions for expressing recombinant S. saprophyticus qoxC in laboratory settings?

For optimal expression of recombinant S. saprophyticus qoxC, researchers should consider a multi-faceted approach:

  • Expression System Selection: E. coli BL21(DE3) or similar strains with reduced protease activity are recommended for membrane protein expression.

  • Induction Parameters: Optimize IPTG concentration (typically 0.1-0.5 mM), temperature (18-30°C), and induction duration (4-24 hours). Lower temperatures (18-20°C) often improve proper folding of membrane proteins.

  • Growth Media Considerations:

    • Use media supplemented with heme precursors (δ-aminolevulinic acid, 50-100 μg/mL)

    • Consider oxygen-limited conditions during expression

    • Test TB (Terrific Broth) or 2xYT media for improved membrane protein yields

  • Solubilization Strategy: Employ gentle detergents (DDM, LMNG, or digitonin) for membrane fraction processing.

These recommendations are based on experimental approaches used for other heme-copper oxidoreductase family proteins, which require careful handling to maintain structural integrity and functional activity .

What experimental controls are essential when characterizing qoxC function in respiration studies?

When designing experiments to characterize qoxC function in S. saprophyticus respiration, the following controls are essential:

Table 1: Essential Controls for qoxC Functional Studies

Control TypePurposeImplementation
Genetic ComplementationVerify phenotypic rescueReintroduce wild-type qoxC into knockout strain
Site-Directed MutantsIdentify critical residuesCreate point mutations in predicted quinol binding sites
Alternative OxidaseDistinguish respiratory pathwaysInhibit quinol oxidase with specific inhibitors (e.g., HQNO)
Electron Donor SpecificityConfirm quinol preferenceTest multiple quinol substrates vs. cytochrome c
Oxygen ConsumptionMeasure direct functionCompare O₂ consumption rates in WT vs. qoxC mutants
Heterologous ExpressionValidate recombinant protein functionExpress in respiratory-deficient model organisms

Proper experimental controls are essential to distinguish direct qoxC effects from indirect metabolic consequences or compensatory mechanisms . Researchers should also consider potential observer effects by implementing double-blind protocols when assessing phenotypic outcomes.

How can homology modeling be used to predict quinol binding sites in S. saprophyticus qoxC?

Homology modeling provides a powerful approach for predicting quinol binding sites in S. saprophyticus qoxC when structural data is unavailable:

  • Template Selection: Identify structurally characterized quinol oxidases from related bacteria. Structural analysis has identified that quinol oxidation evolved independently within the HCO superfamily at least seven times, necessitating careful template selection .

  • Sequence Alignment: Perform multiple sequence alignment focused on conserved regions in quinol-binding domains. Pay particular attention to transmembrane regions where quinol binding typically occurs.

  • Model Construction: Generate homology models using platforms such as SWISS-MODEL, Phyre2, or MODELLER with refinement of transmembrane regions.

  • Binding Site Prediction: Employ computational docking (AutoDock, GOLD) with various quinol substrates to identify potential binding pockets.

  • Conservation Analysis: Analyze evolutionary conservation patterns across staphylococcal species to identify functionally important residues.

  • Validation: Confirm predictions through site-directed mutagenesis of predicted binding site residues and subsequent functional assays.

This approach has successfully identified putative quinol binding sites in several novel quinol oxidases within the HCO superfamily . Key binding site features often include aromatic residues (Trp, Tyr, Phe) for π-stacking interactions with the quinol ring and charged residues to interact with hydroxyl groups.

How does the composition of S. saprophyticus biofilms influence the expression and activity of respiratory enzymes including qoxC?

The relationship between biofilm formation and respiratory enzyme activity in S. saprophyticus represents a complex interaction with significant research implications. Studies have shown that the biofilm matrix of S. saprophyticus consists predominantly of proteins (>75% of the matrix in 98% of isolates), with variable amounts of extracellular DNA and polysaccharides . This protein-rich matrix likely affects local oxygen gradients and substrate availability, creating microenvironments that influence respiratory chain component expression.

Research suggests that biofilm formation in S. saprophyticus is highly prevalent (91% of isolates produce biofilms) regardless of source or genetic lineage . This high prevalence indicates biofilm formation is likely the primary mode of existence for these bacteria, with significant implications for respiratory adaptation:

  • Oxygen Gradient Effects: Cells embedded deeper in biofilms experience oxygen limitation, potentially upregulating alternative respiratory pathways and modifying quinol oxidase expression patterns.

  • Metabolic Adaptation: Biofilm growth likely induces metabolic reprogramming that affects qoxC expression and activity through changes in electron donor availability.

  • Regulatory Crosstalk: Biofilm-associated regulatory networks may directly or indirectly influence respiratory gene expression through quorum sensing and stress response pathways.

The distinct composition of S. saprophyticus biofilms between environmental and clinical isolates suggests that modulation of biofilm structure could represent a key step in the pathogenicity of these bacteria . This variation may extend to differences in respiratory enzyme expression, including qoxC, potentially contributing to adaptation to the urinary tract environment.

What evidence supports horizontal gene transfer of respiratory components like qoxC in S. saprophyticus evolution?

Evidence for horizontal gene transfer (HGT) of respiratory components in S. saprophyticus can be inferred from comparative genomic analyses that have documented acquisition events for other functional gene clusters:

  • Phylogenetic Incongruence: Genomic studies have revealed that the ica gene cluster, involved in biofilm formation, was acquired multiple times by S. saprophyticus from other coagulase-negative staphylococci (CoNS) . Similar mechanisms may have facilitated respiratory gene acquisition.

  • Mobile Genetic Element Association: The complete ica cluster in one S. saprophyticus strain was found within a genomic fragment bracketed by insertion sequences (IS256 and IS1181), resembling a SCCmec-like structure . Respiratory genes may similarly associate with mobile genetic elements.

  • GC Content Variation: Significant deviations in GC content were observed for horizontally acquired genes in S. saprophyticus. For example, icaC and icaR showed extremely low GC content (28.85-30.81% and 25.9-27.84%, respectively) compared to the rest of the genome . Analysis of qoxC GC content could similarly indicate HGT events.

  • Sequence Homology Patterns: The ica genes in S. saprophyticus showed highest homology to those in other staphylococcal species (S. xylosus: 73-78% nucleotide identity; S. fleurettii: ≥99.7% nucleotide identity) . Similar homology patterns in respiratory genes would support HGT.

The documented independent evolution of quinol oxidation within the HCO superfamily at least seven times provides a broader context for potential horizontal transfer of these capabilities between bacterial species.

How do mutations in qoxC affect quinol binding kinetics and proton translocation efficiency?

Mutations in qoxC can significantly alter both quinol binding and proton translocation, with complex effects on respiratory efficiency:

Table 2: Effects of Key qoxC Mutations on Enzyme Function

Molecular dynamics simulations and experimental studies with other quinol oxidases suggest that the quinol binding site architecture creates a distinctive microenvironment that facilitates both electron extraction from quinol and coupled proton translocation . Key residues typically form hydrogen bonds with the hydroxyl groups of quinol while aromatic residues stabilize the ring structure through π-stacking interactions.

Sophisticated biophysical techniques including hydrogen-deuterium exchange mass spectrometry (HDX-MS), electron paramagnetic resonance (EPR) spectroscopy, and time-resolved spectroscopy can help resolve the structural consequences of specific mutations on both binding and proton movement.

What strategies can overcome challenges in membrane protein purification when isolating recombinant S. saprophyticus qoxC?

Purifying membrane proteins like qoxC presents significant technical challenges that require specialized approaches:

  • Extraction Optimization:

    • Test multiple detergent classes systematically (maltosides, glucosides, neopentyl glycols)

    • Implement detergent screening arrays at varying concentrations (0.5-2% w/v)

    • Consider native nanodiscs or styrene maleic acid copolymer (SMA) extraction to maintain native lipid environment

  • Stabilization Techniques:

    • Add cardiolipin (0.01-0.05% w/v) to extraction and purification buffers

    • Maintain reducing conditions with 1-5 mM β-mercaptoethanol or DTT

    • Incorporate glycerol (10-20%) to prevent protein aggregation

  • Affinity Purification Considerations:

    • Position tags (His, FLAG, Strep) at termini least likely to disrupt function

    • Test multiple tag positions if initial constructs show poor expression/activity

    • Consider on-column detergent exchange during purification

  • Quality Assessment:

    • Verify structural integrity via circular dichroism spectroscopy

    • Assess aggregation state through analytical size exclusion chromatography

    • Confirm heme incorporation using absorption spectroscopy (Soret band)

These approaches address the fundamental challenges associated with membrane protein isolation while preserving the structural integrity necessary for functional studies.

How can researchers distinguish between direct qoxC effects and compensatory respiratory adaptations in mutant studies?

Distinguishing direct effects of qoxC mutations from compensatory responses requires a multi-faceted experimental approach:

  • Temporal Analysis:

    • Implement time-course experiments to capture immediate effects before compensatory mechanisms activate

    • Use inducible expression systems or degradation tags for rapid protein depletion

  • Multi-omics Integration:

    • Combine proteomics, transcriptomics, and metabolomics to identify regulatory networks

    • Look for consistent patterns across multiple S. saprophyticus strains and growth conditions

  • Metabolic Flux Analysis:

    • Use 13C-labeled substrates to track changes in carbon flow through central metabolism

    • Quantify respiratory quotients (RQ) to assess shifts between respiratory pathways

  • Genetic Complementation Series:

    • Create a library of partial complementation constructs with varying qoxC expression levels

    • Establish dose-dependency relationships for phenotypic effects

  • Comparative Mutant Analysis:

    • Generate mutations in other respiratory components and compare phenotypic profiles

    • Look for unique signatures specific to qoxC disruption versus general respiratory impairment

These approaches allow researchers to disentangle the direct functional consequences of qoxC mutations from the complex regulatory responses that S. saprophyticus employs to maintain energetic homeostasis.

What statistical approaches are most appropriate for analyzing qoxC activity data across different S. saprophyticus strains?

Analyzing qoxC activity across diverse S. saprophyticus strains requires robust statistical methods that account for biological variation and experimental noise:

  • Hierarchical Linear Models:

    • Account for nested data structures (technical replicates within biological replicates)

    • Include random effects for strain backgrounds to parse strain-specific from treatment effects

    • Allow for unbalanced designs when comparing clinical versus environmental isolates

  • Multiple Comparison Corrections:

    • Implement Benjamini-Hochberg procedure for false discovery rate control

    • Use Tukey's HSD test for post-hoc comparisons between multiple strains

    • Consider sequential Bonferroni correction for planned comparisons

  • Correlation Analysis for Structure-Function Relationships:

    • Apply partial correlation analysis to control for confounding variables

    • Use canonical correlation analysis to relate sets of sequence variants to multiple functional parameters

    • Implement distance-based methods (Mantel tests) to correlate protein sequence similarity with functional similarity

  • Variance Component Analysis:

    • Partition observed variance into components (genetic, environmental, interaction)

    • Quantify heritability of qoxC activity traits across the S. saprophyticus population

    • Identify strain backgrounds with unusual sensitivity to experimental manipulations

When analyzing strain collections, researchers should be mindful of population structure and potential confounding variables. For instance, the observation that S. saprophyticus divides into two main lineages (G and S) necessitates controlling for lineage effects when comparing qoxC function across isolates.

How does qoxC function contribute to S. saprophyticus adaptation in urinary tract infections?

The function of qoxC in quinol oxidase activity likely plays several critical roles in S. saprophyticus adaptation to the urinary tract environment:

  • Oxygen Utilization Efficiency: The urinary tract represents an oxygen-variable environment where efficient terminal electron acceptor utilization provides a competitive advantage. Quinol oxidases directly couple quinol oxidation to oxygen reduction, potentially allowing more efficient energy conservation compared to pathways requiring additional electron carriers .

  • Stress Response Integration: Respiratory chain components like qoxC may participate in managing oxidative stress encountered during host immune responses. The ability to modulate respiratory activity in response to reactive oxygen species could enhance survival during infection.

  • Metabolic Flexibility: S. saprophyticus must adapt to the unique nutrient composition of urine. Quinol oxidases support respiratory flexibility by accommodating electron flow from diverse carbon sources through the quinone pool, facilitating adaptation to changing nutrient availability.

  • Biofilm-Associated Respiration: Given that 91% of S. saprophyticus isolates produce biofilms , respiratory adaptation within biofilm structures likely contributes to persistence. The protein-rich biofilm matrix characteristic of S. saprophyticus may create microenvironments with distinct oxygen tensions, requiring respiratory chain components like qoxC to function under variable conditions.

The observation that biofilm composition differs between environmental and clinical isolates of S. saprophyticus suggests that modulation of the extracellular matrix, and potentially the associated respiratory adaptations, could represent key steps in pathogenicity .

What evolutionary patterns suggest selection pressure on qoxC in clinical versus environmental S. saprophyticus isolates?

Several evolutionary patterns may indicate differential selection pressure on qoxC between clinical and environmental S. saprophyticus isolates:

  • Sequence Conservation Analysis:

    • Higher conservation in functional domains across clinical isolates would suggest purifying selection in the host environment

    • Environmental isolates might show greater sequence diversity reflecting adaptation to varied niches

  • Lineage-Specific Patterns:

    • S. saprophyticus divides into two main lineages (G and S)

    • Examining whether qoxC variants correlate with these lineages could reveal adaptation trajectories

    • Similar to how icaR was found to be lineage G-associated , respiratory components may show lineage-specific distribution

  • Ratio of Synonymous to Non-synonymous Substitutions (dN/dS):

    • Elevated dN/dS ratios in specific domains would indicate positive selection

    • Comparing these ratios between clinical and environmental isolates could reveal differential selective pressures

  • Horizontal Gene Transfer Signatures:

    • Similar to documented acquisition of other genes in S. saprophyticus , evidence of horizontal gene transfer affecting qoxC or the qox operon might indicate selective advantage

    • GC content analysis and codon usage bias could reveal recent acquisition events

  • Co-evolution with Other Respiratory Components:

    • Correlated evolutionary patterns between qoxC and other respiratory chain components would suggest co-adaptation

    • Different correlation patterns between clinical and environmental isolates might reflect niche-specific optimization

The documented differences in biofilm composition between clinical and environmental S. saprophyticus isolates suggest that different niches exert distinct selective pressures on S. saprophyticus biology, which may extend to respiratory chain components like qoxC.

How might CRISPR-Cas9 gene editing be optimized for studying qoxC function in S. saprophyticus?

Optimizing CRISPR-Cas9 gene editing for S. saprophyticus qoxC studies requires addressing several staphylococcal-specific challenges:

These optimizations address the specific challenges of genetic manipulation in staphylococcal species while enabling precise genetic dissection of qoxC function.

What emerging spectroscopic techniques could provide new insights into qoxC electron transfer mechanisms?

Several cutting-edge spectroscopic approaches could reveal unprecedented details about qoxC electron transfer:

  • Time-Resolved Serial Femtosecond Crystallography (TR-SFX):

    • Captures transient intermediates in the catalytic cycle with atomic resolution

    • Requires expression of recombinant protein in quantities suitable for microcrystal formation

    • Can visualize electron and proton movement with sub-picosecond temporal resolution

  • Pulse EPR Techniques:

    • HYSCORE (Hyperfine Sublevel Correlation) spectroscopy can map the electronic environment of metal centers

    • DEER (Double Electron-Electron Resonance) spectroscopy measures distances between paramagnetic centers

    • These approaches can track electron movement through the respiratory complex

  • Vibrational Spectroscopy:

    • Resonance Raman spectroscopy can probe heme environments and conformational changes

    • Time-resolved IR spectroscopy tracks protonation states of key residues

    • Surface-enhanced techniques can increase sensitivity for membrane protein applications

  • Advanced Fluorescence Applications:

    • Site-specific unnatural amino acid incorporation for FRET studies

    • Single-molecule fluorescence to examine conformational heterogeneity

    • Fluorescence lifetime imaging to map protein dynamics in native membranes

  • Cryo-Electron Microscopy:

    • Single-particle analysis for high-resolution structural determination without crystallization

    • Tomography to visualize qoxC in its native membrane environment

    • Time-resolved studies to capture different conformational states

These techniques promise to resolve longstanding questions about the coupling mechanism between electron transfer and proton translocation in quinol oxidases, potentially revealing unique features of the S. saprophyticus respiratory system.

What are the most critical unanswered questions regarding S. saprophyticus qoxC that warrant immediate research attention?

Despite advances in understanding bacterial respiration, several critical questions about S. saprophyticus qoxC remain unanswered:

  • Structure-Function Relationship: How does the specific amino acid sequence of S. saprophyticus qoxC influence its quinol binding specificity and catalytic efficiency compared to other staphylococcal species?

  • Regulatory Networks: What transcriptional and post-translational regulatory mechanisms control qoxC expression in response to environmental conditions encountered during urinary tract colonization?

  • Host Interaction Dynamics: Does qoxC activity contribute to S. saprophyticus persistence during host immune responses, particularly in relation to reactive oxygen species management?

  • Biofilm-Specific Adaptation: How does qoxC function differ between planktonic and biofilm growth states, and does this contribute to the distinct biofilm compositions observed between clinical and environmental isolates ?

  • Evolutionary Trajectory: Did the quinol oxidase complex in S. saprophyticus evolve through vertical inheritance or horizontal gene transfer, similar to the documented acquisition of other gene clusters ?

Addressing these questions would significantly advance our understanding of S. saprophyticus respiratory physiology and potentially reveal new targets for therapeutic intervention in urinary tract infections caused by this pathogen.

How might insights from S. saprophyticus qoxC research inform broader questions in bacterial respiratory chain evolution?

Research on S. saprophyticus qoxC has implications that extend beyond this specific organism, informing our broader understanding of bacterial respiratory adaptation:

  • Convergent Evolution Assessment: The documented independent evolution of quinol oxidation within the HCO superfamily at least seven times provides a natural experiment in convergent evolution. S. saprophyticus qoxC represents one evolutionary solution to the challenge of quinol utilization, and comparative analysis with other independently evolved quinol oxidases can reveal constraints and opportunities in respiratory protein evolution.

  • Host Adaptation Mechanisms: Comparing respiratory chain adaptations between commensal and pathogenic staphylococci could reveal how respiratory flexibility contributes to niche adaptation and host colonization potential.

  • Evolutionary Rate Heterogeneity: Analysis of evolutionary rates across different domains of respiratory proteins could identify hotspots of adaptation versus conservation, illuminating functional constraints on respiratory protein evolution.

  • Horizontal Gene Transfer Dynamics: The documented acquisition of gene clusters like ica in S. saprophyticus raises questions about the frequency and mechanisms of respiratory gene transfer in bacteria, with implications for the spread of metabolic capabilities across diverse ecological niches.

  • Structure-Function Constraints: Detailed characterization of S. saprophyticus qoxC structure and function would contribute to our understanding of how proteins can maintain core functionality (electron transfer and proton translocation) while adapting to specific ecological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.