Recombinant Staphylococcus saprophyticus subsp. saprophyticus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your required tag type during ordering for preferential development.
Synonyms
lgt; SSP1956; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
lgt
Target Protein Sequence
MMTLSYIDPIAFELGPISVRWYGIIIAMGILLGYFIAQASVKRIGFHQDTLVDIIFWSAI FGFIIARIYFVIFQWPYYVQHPIEIPMIWQGGIAIHGGLIGGFVTGIIICKQKNINPFQI GDVIAPSMILGQGIGRWGNFMNHEAHGGTVSKSFLENLHIPDFIINNMYIDGKYYQPTFL YESIWDVLGFVILILLRKHLRIGDTFCLYLIWYSIGRFFVEGMRTDSLMLAGDIRIAQLM SIILIIIGVVIMIVRRVKYDAPRYKAVGPLSWPSKEVK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links

KEGG: ssp:SSP1956

STRING: 342451.SSP1956

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key microbiological features of Staphylococcus saprophyticus?

Staphylococcus saprophyticus is a gram-positive, catalase-positive, coagulase-negative, and urease-positive coccus. Morphologically, it appears spherical under microscopic examination, making it visually difficult to differentiate from other staphylococci such as S. epidermidis and S. aureus. The organism is a member of the normal flora of the female genital tract and perineum, which explains its epidemiological pattern in urinary tract infections. These defining microbiological characteristics are essential for proper identification in laboratory settings and form the foundation for more advanced research inquiries1.

What is the clinical significance of S. saprophyticus in human infections?

S. saprophyticus is the second most common cause of uncomplicated urinary tract infections (UTIs) in young women, following Escherichia coli, accounting for 10-20% of such infections. Despite having higher treatment success rates compared to E. coli UTIs, S. saprophyticus exhibits higher frequencies of recurrent infections. In rare cases, complications can extend beyond simple UTIs to include acute pyelonephritis, nephrolithiasis, and endocarditis. The bacterium's presence in the female genital tract and perineum facilitates its proximity to the urethral opening, creating an opportunistic pathway for infection. Understanding these clinical patterns is crucial for appropriate treatment strategies and epidemiological studies focused on transmission and prevention1 .

What ecological niches does S. saprophyticus occupy beyond human hosts?

S. saprophyticus demonstrates remarkable ecological versatility, inhabiting diverse environments beyond its colonization of humans. The bacterium is commonly found in the gastrointestinal tract and rectal flora of livestock, particularly pigs and cattle. Additionally, it frequently contaminates meat products and fermented foods, indicating its role in food ecosystems. S. saprophyticus has also been recovered from polluted aquatic environments, suggesting environmental adaptation capabilities. This broad ecological distribution has significant implications for understanding transmission patterns, including potential foodborne routes of human infection and environmental reservoirs that may contribute to community spread .

What is the fundamental role of lgt in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (LGT) catalyzes the first step in the post-translational lipid modification of bacterial prolipoproteins. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoprotein signal sequences. This modification is part of a three-step process that ultimately results in the formation of N-acyl diacylglycerylcysteine as the N-terminal structure of mature bacterial lipoproteins. The lipid modification is crucial for anchoring lipoproteins to cell membranes, facilitating their functions in various cellular processes including nutrient acquisition, signaling, and maintaining membrane integrity. The fundamental importance of this enzyme is underscored by its conservation across phylogenetically distant bacterial species .

How conserved is the lgt gene across different bacterial species?

The lgt gene shows significant conservation across phylogenetically distant bacterial species, though with notable variations. Sequence analysis reveals that Staphylococcus aureus LGT (as a representative of gram-positive bacteria) shows 24% identity and 47% similarity with the LGT enzymes from gram-negative bacteria such as Escherichia coli, Salmonella typhimurium, and Haemophilus influenzae. Despite S. aureus LGT being 12 amino acids shorter than the E. coli enzyme, both proteins share similar hydropathic profiles and predicted isoelectric points (pI of approximately 10.4). Multiple sequence alignment has identified regions of highly conserved amino acid sequences throughout the molecule. Particularly noteworthy is the H-103-GGLIG-108 motif, which represents the longest stretch of identical amino acids without any gaps in LGT proteins from all four organisms. This conservation pattern suggests functional significance of these regions in the enzymatic activity .

What is the molecular structure of S. saprophyticus lgt?

Based on comparative analysis with its S. aureus homolog, the prolipoprotein diacylglyceryl transferase from S. saprophyticus likely consists of an open reading frame of approximately 837 base pairs, encoding a protein of around 279 amino acids with a calculated molecular mass of approximately 31.6 kDa. The enzyme is predicted to be a membrane-associated protein with multiple transmembrane domains, reflecting its function in lipid transfer within the bacterial membrane. Key functional regions include conserved motifs such as the H-GGLIG sequence that appears to be critical for catalytic activity. The enzyme's structure facilitates its interaction with both the prolipoprotein substrate and the phospholipid donor (typically phosphatidylglycerol), enabling the transfer of the diacylglyceryl moiety to the cysteine residue within the lipobox of the prolipoprotein signal sequence .

What expression systems are most effective for recombinant S. saprophyticus lgt production?

For effective recombinant expression of S. saprophyticus lgt, E. coli-based expression systems generally yield the best results, particularly when using strains specifically designed for membrane protein expression. The preferred approach involves cloning the lgt gene into vectors with inducible promoters (such as pET or pBAD series) that allow tight regulation of expression. Given the membrane-associated nature of LGT, expression in C41(DE3) or C43(DE3) E. coli strains (derived from BL21(DE3)) is recommended, as these strains are engineered to tolerate membrane protein overexpression. Optimal results are typically achieved by culturing at lower temperatures (16-25°C) after induction and using lower inducer concentrations to prevent formation of inclusion bodies. Additionally, fusion tags such as His6 or Strep tags facilitate purification while maintaining enzyme functionality. Complementation assays using temperature-sensitive lgt mutant strains like E. coli SK634 can effectively verify the functional activity of the recombinant enzyme .

What purification strategies yield the highest activity for recombinant lgt?

Purification of recombinant LGT requires specific strategies to maintain the enzyme's native conformation and activity. The most effective approach involves membrane fraction isolation followed by solubilization using mild detergents such as n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration. Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step for His-tagged proteins, with elution performed using an imidazole gradient (50-300 mM). Further purification can be achieved through size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations. Throughout the purification process, it's critical to maintain the protein in a detergent-containing buffer to prevent aggregation and preserve activity. The purified enzyme should be stored with glycerol (20-25%) at -80°C to maintain stability and activity for extended periods. Activity assays should be performed after each purification step to monitor retention of enzymatic function .

How can the functional activity of purified recombinant lgt be assessed?

The functional activity of purified recombinant LGT can be assessed through both in vivo and in vitro assays. The in vivo approach involves complementation of temperature-sensitive lgt mutant strains such as E. coli SK634, SK635, or SK636. Successful complementation, indicated by growth at non-permissive temperatures, confirms functional enzyme activity. For in vitro assays, the standard method involves measuring the transfer of radiolabeled diacylglycerol from phosphatidyl[³H]glycerol to a synthetic prolipoprotein substrate. The reaction mixture typically contains purified LGT, phosphatidyl[³H]glycerol, synthetic prolipoprotein substrate, and appropriate buffer conditions (pH 7.0-7.5). After incubation (30-60 minutes at 30-37°C), the reaction is stopped by adding chloroform/methanol, and the radiolabeled product is separated by thin-layer chromatography or SDS-PAGE followed by fluorography. Quantification of incorporated radioactivity provides a measure of enzymatic activity. Additionally, non-radioactive assays using mass spectrometry to detect the modified prolipoprotein can serve as alternative approaches for activity assessment .

What is the significance of recombination in S. saprophyticus evolution?

Recombination plays a crucial role in the evolution and genetic diversity of S. saprophyticus populations. Genomic analyses reveal that S. saprophyticus has a recombination to mutation (r/m) ratio of approximately 1.2, similar to the r/m of about 1 reported for S. aureus. This indicates that recombination and mutation contribute almost equally to the genetic diversity observed in S. saprophyticus. For strains associated with urinary tract infections (UTIs), the r/m ratio is slightly higher at 1.5:1, suggesting that recombination events have a more significant impact than point mutations in generating genetic diversity in these clinical isolates. This substantial contribution of recombination to genetic variation likely facilitates the bacterium's adaptation to different ecological niches and hosts, including its transition between environmental reservoirs, animal hosts, and human infections. Understanding these recombination patterns is essential for tracking evolutionary trajectories and the emergence of new pathogenic lineages .

What phylogenetic relationships exist among S. saprophyticus isolates from different sources?

Phylogenetic analysis of S. saprophyticus isolates reveals distinct lineages and clusters associated with different ecological niches and geographical origins. The maximum-likelihood tree constructed from genome-wide SNP data shows several major lineages with both source-specific and mixed clusters. Notably, isolates recovered from similar sources (human infections, livestock, food products, or environmental samples) often cluster together, suggesting niche adaptation. Several clusters (labeled G1-G4 and S1) show evidence of dissemination and transmission within the same country and between different countries, indicating potential international spread of specific lineages. Other clusters (G5-G11 and S2-S4) contain admixtures of isolates from different sources that are closely related by SNPs, suggesting transmission between different reservoirs. This complex phylogenetic structure reflects the bacterium's ability to move between various hosts and environments while undergoing adaptive evolution. These relationships provide important insights for understanding transmission routes, source attribution for human infections, and the ecological dynamics of this versatile pathogen .

What amino acid residues are critical for lgt enzymatic activity?

Several amino acid residues have been identified as critical for LGT enzymatic activity through mutational analysis and chemical modification studies. The most significant is the highly conserved His-103 residue within the invariant H-103-GGLIG-108 motif, which is identical across phylogenetically distant bacteria. Chemical modification studies using diethylpyrocarbonate (DEPC) demonstrated that modification of this histidine residue leads to enzyme inactivation, with the effect being reversible by hydroxylamine treatment at pH 7. This suggests His-103 plays a crucial role in the catalytic mechanism, potentially as a proton donor/acceptor. Additionally, mutational studies of temperature-sensitive lgt mutants identified four residues whose substitution results in defective enzyme activity: Trp-25, Gly-104, Leu-139, and Asp-249. The G104S mutation in E. coli strain SK634 occurs within the highly conserved HGGLIG motif, further emphasizing this region's functional importance. The distribution of these critical residues throughout the protein suggests multiple functional domains contribute to substrate binding and catalytic activity .

How does the secondary structure of lgt relate to its function?

The secondary structure of LGT is intimately connected to its function as a membrane-associated enzyme. Based on hydropathy analyses and structural predictions, LGT contains multiple transmembrane segments that anchor it to the bacterial cytoplasmic membrane. This membrane association is critical for accessing both the prolipoprotein substrate and the phospholipid donor. The active site appears to be positioned at the membrane interface, allowing interaction with both hydrophilic and hydrophobic portions of the substrates. The conserved H-103-GGLIG-108 motif likely resides within a loop or turn structure that contributes to the active site, with the glycine residues (G104, G105, G108) providing the structural flexibility needed for proper substrate orientation. The functional importance of specific secondary structure elements is evidenced by the temperature-sensitive phenotypes resulting from point mutations, which likely disrupt critical structural features required for catalytic activity. This structure-function relationship explains why even conservative amino acid substitutions in key regions can significantly impair enzymatic function .

What experimental approaches best elucidate structure-function relationships in lgt?

Multiple complementary experimental approaches have proven effective in elucidating structure-function relationships in LGT. The most informative strategy combines:

  • Comparative sequence analysis across phylogenetically distant species to identify conserved motifs

  • Site-directed mutagenesis of conserved residues followed by activity assays

  • Analysis of naturally occurring mutants with altered enzyme function

  • Chemical modification studies targeting specific amino acid types

  • Membrane topology mapping using reporter fusions

This integrated approach has successfully identified functional regions throughout the LGT protein. For example, analysis of temperature-sensitive lgt mutants revealed single amino acid substitutions that impair enzyme function, while chemical modification with DEPC demonstrated the essential role of histidine residues. The inactivation kinetics (shown in Table 1) were consistent with modification of a single essential residue, with a second-order rate constant of 18.6 M⁻¹s⁻¹.

DEPC Concentration (μM)Inactivation Rate (kobs, min⁻¹)
350.65
701.30
1402.61

Further advances in understanding structure-function relationships would benefit from protein crystallography or cryo-EM studies to determine the three-dimensional structure of LGT, though these approaches present technical challenges due to the membrane-associated nature of the enzyme .

How can recombinant lgt be utilized in vaccine development?

Recombinant LGT offers significant potential for vaccine development strategies, particularly in creating lipid-modified protein antigens with enhanced immunogenicity. The enzyme can be employed to enzymatically modify recombinant antigens with lipid moieties, creating lipoproteins that better mimic bacterial surface antigens. These lipid-modified antigens typically elicit stronger immune responses through enhanced interaction with pattern recognition receptors such as Toll-like receptor 2 (TLR2), which recognizes bacterial lipoproteins. The approach involves co-expression of the antigen of interest (engineered with an appropriate lipobox motif) and recombinant LGT in an expression system, followed by purification of the lipid-modified antigen. Alternatively, in vitro modification of purified proteins using recombinant LGT and suitable phospholipid donors can be performed. This strategy has potential applications in developing vaccines against S. saprophyticus UTIs, as well as other bacterial infections where lipoproteins serve as protective antigens. The controlled lipid modification of antigens provides an advantage over traditional adjuvants by directly incorporating the immunostimulatory lipid component into the antigen structure .

What are the implications of lgt research for developing novel antimicrobials?

Research on LGT has significant implications for developing novel antimicrobial strategies targeting bacterial lipoprotein biosynthesis. As LGT catalyzes the first and essential step in bacterial lipoprotein modification, its inhibition would disrupt the proper localization and function of numerous lipoproteins critical for bacterial physiology. Several characteristics make LGT an attractive antimicrobial target: (1) it is highly conserved across bacterial species yet absent in eukaryotes, offering selective toxicity; (2) the enzyme contains essential catalytic residues that could be targeted by small-molecule inhibitors; and (3) the H-103-GGLIG-108 motif provides a specific structural feature for rational drug design. Potential antimicrobial strategies include developing small-molecule inhibitors that compete with either the prolipoprotein substrate or the phospholipid donor, designing peptidomimetics that interfere with substrate binding, or creating mechanism-based inactivators targeting the catalytic histidine residue. High-throughput screening methods using the in vitro LGT assay could identify lead compounds for further development. Such antimicrobials could have broad-spectrum activity against both gram-positive and gram-negative bacteria, potentially addressing the growing challenge of antibiotic resistance .

How can lgt be engineered for improved catalytic efficiency or substrate specificity?

Engineering LGT for improved catalytic properties requires strategic modifications based on structure-function relationships. Several approaches show promise:

  • Directed evolution through error-prone PCR or DNA shuffling, followed by selection for variants with enhanced catalytic properties using complementation of lgt-deficient strains.

  • Rational design focusing on modifying residues near but not within the catalytic site to improve substrate binding or product release without disrupting the catalytic mechanism.

  • Creating chimeric enzymes by combining domains from LGT homologs from different species to potentially expand substrate range or improve stability.

  • Site-directed mutagenesis of non-conserved residues near the active site to alter substrate specificity, potentially allowing modification of non-natural substrates.

Specific targets for engineering include:

  • Modifying residues surrounding the H-103-GGLIG-108 motif to enhance substrate binding

  • Altering transmembrane domains to improve membrane integration and stability

  • Engineering the enzyme's N-terminal region to enhance expression levels in recombinant systems

Success in these engineering efforts requires establishing reliable high-throughput activity assays and detailed structural information. Potential applications include developing enzymes capable of incorporating modified lipids or recognizing non-canonical lipobox sequences, which could expand the toolkit for protein lipidation in synthetic biology applications .

What are the main challenges in expression and purification of recombinant lgt?

Expression and purification of recombinant LGT presents several significant challenges owing to its nature as an integral membrane protein. The primary difficulties include:

  • Toxicity to host cells: Overexpression of membrane proteins often disrupts membrane integrity, leading to growth inhibition or cell death. This can be addressed by using tightly regulated expression systems (such as pBAD vectors) and reduced growth temperatures (16-20°C) post-induction.

  • Formation of inclusion bodies: LGT tends to aggregate when overexpressed, forming insoluble inclusion bodies with incorrect folding. This can be mitigated by reducing expression levels through lower inducer concentrations and using specialized E. coli strains (C41/C43) designed for membrane protein expression.

  • Low yield: Membrane proteins typically express at lower levels than soluble proteins. This can be partially overcome by scaling up cultures and optimizing media composition with additives like glycerol that stabilize membrane proteins.

  • Maintaining activity during solubilization: Extracting LGT from membranes requires detergents that can potentially denature the protein. Screening multiple detergents (DDM, OG, LDAO) at various concentrations is essential to identify conditions that maintain enzyme activity. Incorporating phospholipids during purification can help stabilize the native conformation.

  • Protein heterogeneity: Purified LGT often exists in multiple oligomeric states or with varying degrees of lipid/detergent association. Size exclusion chromatography and analytical ultracentrifugation can help isolate homogeneous preparations for structural and functional studies .

How can researchers effectively assay lgt activity in different experimental contexts?

Researchers can employ various complementary approaches to assay LGT activity across different experimental contexts:

For in vivo functional assessment:

  • Complementation assays using temperature-sensitive lgt mutant strains (E. coli SK634, SK635, SK636) provide a straightforward method to confirm enzyme functionality. Expression of active LGT restores growth at non-permissive temperatures.

  • Metabolic labeling of bacterial cultures with [³H]palmitate or [³H]glycerol followed by immunoprecipitation of specific lipoproteins can quantify in vivo lipoprotein modification.

For in vitro biochemical characterization:

  • Radioisotope-based assays using phosphatidyl[³H]glycerol as the lipid donor and synthetic peptides containing lipobox sequences as acceptors provide quantitative activity measurements. The lipidated products can be detected by thin-layer chromatography or SDS-PAGE with fluorography.

  • Mass spectrometry-based assays offer non-radioactive alternatives by detecting the mass shift associated with diacylglyceryl addition to substrate peptides or proteins.

  • Fluorescence-based assays using substrates with environmentally sensitive fluorophores can enable real-time monitoring of enzymatic activity.

For high-throughput applications:

  • FRET-based assays using appropriately labeled substrate analogs can be adapted to microtiter plate formats for inhibitor screening.

  • Whole-cell reporter systems where lipoprotein modification is coupled to easily detectable signals (fluorescence, luminescence) enable screening of large compound libraries.

Each assay method has specific advantages and limitations in terms of sensitivity, throughput, and compatibility with different experimental objectives .

What statistical approaches are most appropriate for analyzing genetic diversity in S. saprophyticus lgt genes?

The analysis of genetic diversity in S. saprophyticus lgt genes requires specialized statistical approaches that account for the evolutionary processes shaping sequence variation. The most appropriate methods include:

  • Sequence-based diversity metrics:

    • Nucleotide diversity (π) and Watterson's theta (θ) to quantify genetic variation

    • Tajima's D test to detect departures from neutrality that might indicate selection pressure

    • dN/dS ratio (ratio of non-synonymous to synonymous substitution rates) to identify signatures of positive or purifying selection on the lgt gene

  • Recombination analysis:

    • ClonalFrameML to detect recombination events and calculate the r/m ratio specific to the lgt gene

    • RDP4 software suite to identify potential recombination breakpoints within the gene

    • Phi test to statistically evaluate the presence of recombination

  • Population structure analysis:

    • STRUCTURE or BAPS algorithms to detect potential subpopulations based on lgt sequences

    • FST calculations to quantify genetic differentiation between isolates from different sources

  • Phylogenetic approaches:

    • Maximum likelihood or Bayesian phylogenetic methods to reconstruct evolutionary relationships

    • Ancestral sequence reconstruction to infer the evolutionary history of specific functional motifs

  • Comparative genomics statistics:

    • Genome-wide association studies (GWAS) to identify lgt variants associated with specific phenotypes

    • Analysis of selection pressure variation across different domains of the protein

For robust interpretation, a combination of these methods should be employed, and results should be evaluated in the context of evolutionary models specific to bacterial populations with mixed recombination and mutation dynamics. Sample size considerations are particularly important, with a minimum of 30-50 diverse isolates typically needed for meaningful statistical inference .

What are the promising avenues for future research on S. saprophyticus lgt?

Future research on S. saprophyticus lgt holds several promising avenues for investigation:

  • Structural biology: Determining the three-dimensional structure of S. saprophyticus LGT through X-ray crystallography or cryo-electron microscopy would provide critical insights into its catalytic mechanism and substrate binding. While technically challenging due to its membrane protein nature, recent advances in membrane protein structural biology make this increasingly feasible.

  • Substrate specificity profiling: Comprehensive analysis of LGT substrate preferences using synthetic peptide libraries would help define the molecular determinants of specificity and potentially reveal organism-specific adaptations in lipoprotein processing.

  • Inhibitor development: High-throughput screening campaigns coupled with structure-based drug design could identify specific inhibitors of LGT activity. Lead compounds could be further developed as potential antimicrobial agents, particularly against multi-drug resistant pathogens.

  • Ecological role: Investigating how variations in the lgt gene contribute to S. saprophyticus adaptation across diverse ecological niches (human hosts, livestock, food, environment) could provide insights into the bacterium's evolution and host-pathogen interactions.

  • Pathogenesis studies: Exploring the role of LGT-dependent lipoproteins in S. saprophyticus virulence using isogenic mutants and animal models of urinary tract infection would clarify the enzyme's contribution to pathogenesis.

  • Immunological applications: Developing LGT-based approaches for creating lipidated vaccine antigens could lead to improved vaccines against UTIs and other bacterial infections .

How might advances in structural biology impact our understanding of lgt function?

Advances in structural biology would dramatically transform our understanding of LGT function through multiple dimensions:

  • Catalytic mechanism elucidation: A high-resolution structure would definitively identify the catalytic residues and their spatial arrangement, clarifying how the enzyme facilitates diacylglyceryl transfer. This would resolve current hypotheses about the role of the conserved His-103 residue and other potentially important amino acids.

  • Substrate binding insights: Structural studies, particularly co-crystallization with substrate analogs or product mimics, would reveal how both the prolipoprotein substrate and phospholipid donor interact with the enzyme. This would explain the molecular basis for specificity and potential differences between LGT enzymes from different bacterial species.

  • Membrane integration understanding: Determining how LGT integrates into the bacterial membrane would explain how it accesses its lipid substrate and positions the active site for catalysis. This would clarify whether the enzyme contains a lateral opening for lipid access or requires lipids to diffuse into a central cavity.

  • Conformational dynamics: Advanced techniques like hydrogen-deuterium exchange mass spectrometry or single-molecule FRET could reveal conformational changes during the catalytic cycle, potentially identifying transient states critical for function.

  • Rational drug design facilitation: A detailed structure would enable computational docking studies and fragment-based drug design approaches to develop specific inhibitors targeting the active site or allosteric regions of the enzyme.

  • Evolutionary insights: Comparing LGT structures across evolutionarily distant bacteria would reveal conserved structural elements beyond sequence similarity, potentially identifying convergent solutions to catalytic challenges and explaining the basis for maintained function despite sequence divergence .

What potential clinical applications might emerge from advanced understanding of S. saprophyticus lgt?

Advanced understanding of S. saprophyticus LGT could lead to several significant clinical applications:

  • Novel antimicrobial development: Detailed knowledge of LGT structure and function could facilitate the design of specific inhibitors targeting this essential enzyme. Such inhibitors could form the basis of a new class of antibiotics with activity against multi-drug resistant gram-positive pathogens, including not only S. saprophyticus but potentially also S. aureus and other staphylococci.

  • Improved diagnostic tools: Understanding LGT-dependent lipoprotein expression patterns in S. saprophyticus could lead to the identification of specific biomarkers for rapid diagnostic tests. These could enable faster, more specific identification of S. saprophyticus UTIs, allowing for targeted antimicrobial therapy.

  • Vaccine development: LGT-modified surface lipoproteins represent potential vaccine antigens. Recombinant LGT could be used to create lipid-modified protein antigens with enhanced immunogenicity for vaccine formulations targeting S. saprophyticus and potentially other uropathogens.

  • Pathogenesis-targeted interventions: Insights into how LGT-dependent lipoproteins contribute to S. saprophyticus pathogenesis could reveal new targets for anti-virulence therapies that disrupt colonization or infection without selecting for resistance.

  • Risk assessment tools: Genomic analysis of lgt variants might identify specific alleles associated with increased virulence or recurrence potential, enabling better risk stratification of patients with S. saprophyticus UTIs.

  • Drug delivery systems: Engineered LGT could potentially be used to create lipid-modified drug carriers with enhanced cellular uptake properties or improved pharmacokinetics for various therapeutic applications beyond direct antimicrobial use .

What are the key takeaways from current research on S. saprophyticus lgt?

Current research on S. saprophyticus prolipoprotein diacylglyceryl transferase (lgt) reveals several key insights with significant implications for both basic science and applied research. First, the enzyme plays an essential role in bacterial physiology by catalyzing the initial step in lipoprotein modification, a process critical for proper membrane protein localization and function. Second, comparative genomic analyses have demonstrated remarkable conservation of specific motifs (particularly H-103-GGLIG-108) across phylogenetically distant bacteria, indicating their functional importance in catalysis. Third, mutational and chemical modification studies have identified specific residues essential for enzyme activity, providing important structure-function insights despite the absence of a resolved three-dimensional structure. Fourth, the genetic diversity of S. saprophyticus, including its lgt gene, is shaped by both mutation and recombination processes, with an r/m ratio of approximately 1.2. Finally, the enzyme represents a promising target for antimicrobial development due to its essential nature, conservation across bacterial species, and absence in mammalian cells. Together, these findings establish a strong foundation for future investigations into both the fundamental biology of bacterial lipoprotein modification and potential therapeutic applications targeting this process .

How does research on S. saprophyticus lgt contribute to broader understanding of bacterial physiology?

Research on S. saprophyticus lgt contributes significantly to our broader understanding of bacterial physiology through multiple avenues. First, it illuminates the essential process of lipoprotein modification, which affects numerous cellular functions including nutrient acquisition, signaling, stress responses, and cell envelope integrity. Second, comparative studies of lgt across different bacterial species provide insights into the evolution of core cellular processes and how they are adapted for specific ecological niches. Third, the characterization of structure-function relationships in LGT enhances our understanding of membrane-associated enzymes and their catalytic mechanisms. Fourth, the recombination patterns observed in S. saprophyticus, including those potentially affecting the lgt gene, contribute to our knowledge of bacterial genome plasticity and adaptive evolution. Fifth, the investigation of LGT's role in pathogenesis connections between basic physiological processes and virulence mechanisms. Finally, the optimization of recombinant expression systems for LGT advances methodologies for studying challenging membrane proteins in various bacterial systems. Collectively, these contributions extend well beyond S. saprophyticus biology, informing fundamental concepts in bacterial physiology, evolution, and host-pathogen interactions that are applicable across microbiology .

What integrative approaches would most effectively advance the field of S. saprophyticus lgt research?

Advancing S. saprophyticus lgt research most effectively requires integrative approaches that combine multiple disciplines and methodologies:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.