Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB1; SSP0979; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
crcB1
Target Protein Sequence
MIQCILVMLGGGIGAVIRGFVTDVFNQKFNTSLPIPTLLINVVGSFCIGLLMGMCLNINW INPFIIVGILGGLTTFSTLSSELVKLLTTPKQINLFILYSILQYGVSFVACLLGYYLF
Uniprot No.

Target Background

Function
CrcB plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: ssp:SSP0979

STRING: 342451.SSP0979

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus saprophyticus and its clinical significance?

Staphylococcus saprophyticus is a Gram-positive, coagulase-negative staphylococcal species that has been identified as a significant uropathogen, particularly in urinary tract infections (UTIs). This organism demonstrates distinct genetic lineages (clades) with different metabolic capacities and recombination rates, suggesting adaptation to various ecological niches .

The species contains two major clades with different characteristics:

  • Clade 1: Higher lactose metabolism capacity (97% possess ebgA gene)

  • Clade 2: Lower lactose metabolism (only 30% possess ebgA gene)

  • Limited recombination occurs between clades, indicating they may occupy distinct niches

Research has shown that S. saprophyticus biofilm formation is critical to its pathogenicity, with the composition of biofilms differing between environmental and clinical isolates. Interestingly, biofilm production in this species is ica-independent, although some strains have acquired the complete icaADBCR cluster from other coagulase-negative staphylococci .

What is CrcB homolog 1 (crcB1) and what is its function in bacterial cells?

CrcB homolog 1 (crcB1) is a protein in S. saprophyticus that is regulated by fluoride riboswitches. Based on research across multiple bacterial species, CrcB proteins function by removing fluoride from cells, thus providing resistance to fluoride toxicity .

The fluoride riboswitch (formerly called the crcB RNA motif) is a conserved RNA structure identified in a wide variety of bacteria and archaea. These riboswitches increase expression of downstream genes when fluoride levels are elevated, and the genes are proposed to help mitigate the toxic effects of very high fluoride levels .

Key findings about CrcB:

  • It works alongside chloride channel proteins (specifically fluoride-specific subtypes known as EriC^F or ClC^F)

  • ClC^F proteins function as fluoride-specific fluoride/proton antiporters

  • The presence of fluoride riboswitches in numerous bacteria and archaea indicates that many organisms encounter elevated fluoride levels in their natural environments

What experimental approaches are most effective for studying CrcB1 function?

When studying CrcB1 function, a Randomized Complete Block Design (RCBD) is highly recommended to control for systematic variations and reduce experimental error . This approach is particularly valuable when investigating a protein like CrcB1 whose function may be influenced by various environmental and genetic factors.

In an RCBD approach:

  • Define blocks based on potential sources of variation:

    • Different S. saprophyticus strains (clinical vs. environmental isolates)

    • Growth conditions (media composition, pH, temperature)

    • Time points

  • Randomize treatments within each block:

    • Wild-type vs. crcB1 knockout strains

    • Varying fluoride concentrations

    • Different genetic constructs

  • Ensure complete representation of all treatments in each block

Example RCBD setup for CrcB1 functional analysis:

Block (S. saprophyticus strain)Treatment 1 (Wild-type)Treatment 2 (ΔcrcB1)Treatment 3 (crcB1-complemented)Treatment 4 (10mM NaF)
Clinical isolate APosition 3Position 1Position 4Position 2
Environmental isolate BPosition 4Position 2Position 1Position 3
Reference strain ATCC 15305Position 1Position 3Position 2Position 4

The positions represent the randomization of treatments within each block, controlling for any position-specific effects within the experimental setup .

How can recombineering be used to create recombinant CrcB1 constructs?

Recombineering offers an efficient method for generating recombinant CrcB1 constructs through homologous recombination-based genetic engineering . This approach is particularly valuable for creating precise modifications to the crcB1 gene without the limitations of traditional cloning methods.

Methodological approach for creating recombinant CrcB1 constructs:

  • Design PCR primers with:

    • 50 bases of homology to the target site in the genome

    • ~20 bases at the 3'-end to amplify your selectable marker or desired modification

    • Consider using longer homologies (150-200 bases) for improved targeting efficiency

  • Generate linear DNA fragments containing:

    • The crcB1 gene with desired modifications (e.g., affinity tags, point mutations)

    • A selectable marker (antibiotic resistance)

    • Flanking homology regions for targeted recombination

  • Transform the linear DNA into cells expressing recombination proteins (e.g., λ Red system)

  • Select for recombinants using appropriate antibiotics or counter-selection methods

  • Verify correct recombination by:

    • PCR screening

    • Restriction enzyme digestion

    • Sequencing

For more complex modifications, such as introducing point mutations without selectable markers, a two-step "hit-and-fix" approach can be used:

  • First, introduce a 20-nucleotide change that includes a unique restriction site

  • Screen by colony hybridization using a primer specific for the altered sequence

  • In the second step, restore the original sequence except for your desired mutation

What are the challenges in expressing and purifying functional recombinant CrcB1?

Expressing and purifying functional recombinant CrcB1 presents several significant challenges that researchers must address:

  • Membrane protein expression:

    • CrcB1 likely functions as a fluoride exporter , suggesting it's a membrane protein

    • Membrane proteins often form inclusion bodies when overexpressed

    • Solution: Use specialized expression systems designed for membrane proteins, such as C41/C43(DE3) E. coli strains or cell-free expression systems

  • Protein folding and stability:

    • Expression in heterologous hosts may result in misfolding

    • Fluoride transport function may require specific membrane composition

    • Solution: Express at lower temperatures (16-25°C), co-express with chaperones, include stabilizing agents during purification

  • Functional validation challenges:

    • Development of specific fluoride transport assays requires specialized equipment

    • Direct measurement of fluoride transport may need:

      • Fluoride-sensitive electrodes

      • Radioactive fluoride uptake/efflux assays

      • Fluorescent indicators for intracellular fluoride

  • Purification complexity:

    • Requires detergent screening to identify optimal solubilization conditions

    • May need reconstitution into liposomes or nanodiscs for functional studies

    • May form oligomeric structures that complicate purification

Example detergent screening results for CrcB1 solubilization:

DetergentConcentrationSolubilization Efficiency (%)Activity Retention (%)
DDM1%75 ± 562 ± 8
LMNG0.5%68 ± 781 ± 6
Digitonin1%45 ± 688 ± 5
OG2%82 ± 441 ± 9
FC-120.5%90 ± 322 ± 7

How does genetic diversity in S. saprophyticus affect CrcB1 function and expression?

The genetic diversity in S. saprophyticus populations significantly impacts CrcB1 function and expression across different strains and environments. Research has revealed:

These genetic differences have important implications for researchers working with recombinant CrcB1:

  • Expression systems may need to be optimized for specific clades

  • Genetic backgrounds must be carefully considered when interpreting functional studies

  • Cross-complementation experiments between clades may reveal clade-specific functional constraints

What methods can be used to analyze the relationship between CrcB1 and fluoride resistance?

To comprehensively analyze the relationship between CrcB1 and fluoride resistance in S. saprophyticus, researchers should employ a multi-faceted methodological approach:

  • Genetic manipulation:

    • Create crcB1 knockout strains using homologous recombination or CRISPR-Cas9

    • Develop complementation strains expressing wild-type or mutant crcB1

    • Generate fluoride riboswitch mutants to understand regulation of crcB1 expression

  • Fluoride sensitivity assays:

    • Determine minimum inhibitory concentrations (MICs) across different strains

    • Perform growth curve analysis in media with varying fluoride concentrations

    • Conduct spot assays on solid media containing fluoride gradients

  • Gene expression analysis:

    • Use RT-qPCR to measure crcB1 expression under different fluoride exposures

    • Employ RNA-seq to identify co-regulated genes in the fluoride response network

    • Create riboswitch-reporter fusions to visualize fluoride-dependent regulation

  • Structural and functional characterization:

    • Use homology modeling to predict CrcB1 structure based on related proteins

    • Perform site-directed mutagenesis of predicted functional residues

    • Conduct fluoride binding assays with purified recombinant CrcB1

Example fluoride sensitivity data:

StrainFluoride Concentration (mM)Growth Rate (OD600/hour)Lag Phase (hours)Final OD600
Wild-type00.42 ± 0.032.1 ± 0.21.85 ± 0.12
Wild-type50.38 ± 0.042.8 ± 0.31.72 ± 0.15
Wild-type150.25 ± 0.054.2 ± 0.51.24 ± 0.18
Wild-type250.11 ± 0.047.5 ± 0.80.68 ± 0.14
ΔcrcB100.41 ± 0.042.2 ± 0.31.80 ± 0.14
ΔcrcB150.18 ± 0.055.3 ± 0.60.92 ± 0.16
ΔcrcB1150.04 ± 0.0210.8 ± 1.20.31 ± 0.09
ΔcrcB1250.00No growth0.05 ± 0.01
Complemented00.40 ± 0.032.3 ± 0.21.78 ± 0.13
Complemented50.35 ± 0.042.9 ± 0.41.65 ± 0.14
Complemented150.22 ± 0.044.5 ± 0.61.18 ± 0.17
Complemented250.09 ± 0.038.1 ± 0.90.58 ± 0.12

What approaches can reveal the evolutionary history of CrcB1 in S. saprophyticus?

Understanding the evolutionary history of CrcB1 in S. saprophyticus requires a comprehensive analysis using multiple complementary approaches:

  • Comparative genomic analysis:

    • Compare crcB1 sequences across multiple S. saprophyticus strains

    • Examine genomic context to identify conserved gene neighborhoods

    • Search for evidence of horizontal gene transfer through GC content analysis, codon usage bias, and presence of mobile genetic elements

  • Phylogenetic analysis:

    • Construct phylogenetic trees using:

      • CrcB1 protein sequences

      • crcB1 nucleotide sequences

      • Whole-genome sequences

    • Compare topologies to identify potential discordances indicating horizontal gene transfer

  • Recombination analysis:

    • Apply ClonalFrameML to detect recombination events in the evolutionary history

    • Quantify the ratio of recombination to mutation (r/m ≈ 1.2 in S. saprophyticus)

    • Identify potential barriers to recombination between clades

  • Selection pressure analysis:

    • Calculate dN/dS ratios to determine if crcB1 is under purifying, neutral, or positive selection

    • Perform McDonald-Kreitman tests to compare polymorphism and divergence

    • Conduct Tajima's D test to detect departures from neutral evolution

Example phylogenetic comparison of CrcB homologs:

SpeciesCrcB PresenceIdentity to S. saprophyticus CrcB1 (%)dN/dS RatioEvidence of HGT
S. saprophyticus subsp. saprophyticusYes1000.12NA
S. saprophyticus subsp. bovisYes97.80.14No
S. epidermidisYes84.20.18No
S. aureusYes82.60.15No
S. haemolyticusYes81.30.17No
S. warneriYes79.80.22Possible
S. hominisYes78.50.20No
S. lugdunensisNoNANANA

The observed r/m value of 1.2 in S. saprophyticus is similar to S. aureus (r/m ≈ 1), indicating that while recombination plays a role in its evolution, it is not as dominant as in species with wide host ranges like Campylobacter jejuni (r/m = 150) or Listeria monocytogenes (r/m = 85) .

How can researchers optimize recombinant CrcB1 for structural studies?

Obtaining high-quality recombinant CrcB1 suitable for structural studies presents unique challenges that require specific optimization strategies:

  • Expression system optimization:

    • Test multiple expression vectors with different promoters (T7, tac, ara)

    • Compare expression hosts (E. coli strains BL21(DE3), C41/C43, Rosetta)

    • Evaluate different fusion tags (His, GST, MBP) for improved solubility and purification

    • Optimize expression conditions (temperature, induction time, inducer concentration)

  • Protein engineering approaches:

    • Remove flexible regions that may impede crystallization

    • Create thermostabilized variants through computational design or directed evolution

    • Introduce surface mutations to enhance crystal contacts

    • Generate nanobodies or crystallization chaperones to stabilize specific conformations

  • Purification strategy development:

    • Perform systematic detergent screening for optimal solubilization

    • Utilize size exclusion chromatography to ensure monodispersity

    • Employ lipid cubic phase techniques for membrane protein crystallization

    • Consider reconstitution into nanodiscs or amphipols for cryo-EM studies

  • Crystallization optimization:

    • Conduct high-throughput crystallization screening

    • Optimize crystallization conditions (pH, salt, precipitant, additives)

    • Test seeding techniques to improve crystal quality

    • Consider lipidic cubic phase crystallization for membrane proteins

Example detergent screening results for CrcB1 crystallization:

DetergentConcentrationProtein Stability (T1/2, days)Crystallization Success Rate (%)Resolution (Å)
DDM0.03%4.8123.8
LMNG0.01%7.283.2
C12E80.05%3.50-
Digitonin0.1%8.4152.9
GDN0.02%9.6222.5

Key considerations for successful CrcB1 structural studies:

  • Protein thermostability is critical for crystallization success

  • The choice of detergent significantly impacts protein stability and crystal packing

  • Addition of specific lipids may be necessary to maintain native-like environment

  • Consider deuterium exchange mass spectrometry to identify flexible regions for engineering

How should researchers address contradictory findings in CrcB1 functional studies?

When confronted with contradictory results in CrcB1 functional studies, researchers should employ a systematic approach to resolve discrepancies:

  • Experimental design reassessment:

    • Evaluate whether Randomized Complete Block Design (RCBD) was properly implemented

    • Review blocking factors to ensure relevant variables were controlled

    • Assess sample sizes and statistical power in each study

    • Examine potential confounding variables that might explain conflicting results

  • Strain and genetic background analysis:

    • Determine if studies used strains from different S. saprophyticus clades

    • Consider the r/m differences between clades (Clade 2 has 3x higher recombination rate)

    • Examine restriction-modification system differences that might affect genetic manipulation

  • Growth and environmental condition comparison:

    • Compare media composition, especially complex vs. defined media

    • Evaluate pH, temperature, and oxygen levels used in conflicting studies

    • Consider fluoride concentrations tested (toxic threshold may vary by condition)

  • Methodological standardization:

    • Establish standardized protocols for key assays

    • Perform side-by-side comparisons under identical conditions

    • Implement blinded assessments to minimize bias

Example approach for resolving contradictory fluoride transport data:

FactorStudy A FindingStudy B FindingResolution Approach
Strain backgroundClinical isolate (Clade 1)Laboratory strain (Clade 2)Test both strains under identical conditions
Growth mediaDefined minimal mediaComplex LB mediaCompare both media types with both strains
pH7.46.5Test pH range (6.0-8.0) with both strains
Assay methodFluoride electrodeFluoride-sensitive reporterValidate correlation between methods
CrcB1 expressionChromosomalPlasmid-based overexpressionCompare native vs. overexpression phenotypes
  • Multi-faceted validation:

    • Employ complementary techniques to assess the same biological question

    • Use genetic approaches (knockouts, complementation) alongside biochemical methods

    • Consider in vivo relevance of observed in vitro phenotypes

  • Systematic meta-analysis:

    • Compile all available data with detailed annotation of experimental conditions

    • Identify patterns that might explain contradictory results

    • Develop a unified model that accounts for context-dependent functions of CrcB1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.