Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify this in your order; we will prioritize its inclusion.
Synonyms
crcB2; SSP0980; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
crcB2
Target Protein Sequence
MQYLFIFLGGAVGALLRYLLSFINTSFEMPIGTFIANLCGAFLMGFLGTLAIQYFNNSPM LKKGITTGFIGSLTTFSTFQFELVQFFESGSFILLIVYALTSYIFGILLCFLGVRLGAKI S
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links

KEGG: ssp:SSP0980

STRING: 342451.SSP0980

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 2 and what is its significance in bacterial research?

The CrcB homolog 2 (crcB2) is a protein expressed in Staphylococcus saprophyticus subsp. saprophyticus, a coagulase-negative staphylococcal species with established uropathogenic properties. While specific research on crcB2 is limited, its significance stems from S. saprophyticus's role as a clinically relevant pathogen, particularly in urinary tract infections. S. saprophyticus biofilm formation capabilities contribute significantly to its pathogenicity in clinical settings, suggesting potential involvement of membrane proteins like crcB2 in this process . Studying crcB2 could provide insights into bacterial membrane biology and potential virulence mechanisms. The protein is available as a recombinant product for research applications, allowing for controlled investigation of its properties outside native bacterial contexts .

How do researchers differentiate between the various protein homologs in Staphylococcus saprophyticus?

Differentiating between protein homologs in S. saprophyticus requires multiple complementary approaches. Genomic analysis serves as the primary method, where researchers examine nucleotide sequence identity, gene synteny, and comparative genomics against related species such as S. xylosus and S. equorum, which exhibit approximately 80% nucleotide identity with S. saprophyticus genes . Proteomic characterization using techniques like mass spectrometry and structural prediction algorithms helps distinguish functional domains that may differ between homologs despite sequence similarities. Evolutionary analysis examines acquisition patterns, as seen with ica genes in S. saprophyticus, which show evidence of both vertical inheritance during speciation and horizontal gene transfer from other staphylococcal species . Expression profiling under various conditions further elucidates functional differences between homologs, informing their potential specialized roles.

What methodologies are most effective for identifying the subcellular localization of crcB2?

For determining crcB2 subcellular localization, researchers should implement a multi-faceted experimental approach. Begin with bioinformatic prediction tools that analyze protein sequences for transmembrane domains, signal peptides, and localization signals—crucial for hypothesizing initial localization. Subsequently, employ fluorescent protein fusion techniques where crcB2 is tagged with GFP or similar fluorescent proteins and visualized via confocal microscopy in living bacterial cells. Subcellular fractionation protocols optimized for staphylococcal species provide biochemical evidence by separating membrane, cytoplasmic, and periplasmic fractions followed by Western blot analysis using crcB2-specific antibodies. Immunogold electron microscopy offers nanometer-scale resolution of protein localization within bacterial ultrastructure. For definitive functional validation, utilize site-directed mutagenesis to modify predicted localization signals and observe changes in protein distribution and associated phenotypes.

What are the optimal expression systems for producing functional recombinant crcB2 protein?

The optimal expression systems for recombinant crcB2 production require careful consideration of multiple factors to ensure functional integrity. For prokaryotic expression, E. coli BL21(DE3) strains with T7 promoter-driven expression vectors provide high yields, though membrane proteins like crcB2 may require specialized strains such as C41(DE3) or C43(DE3) designed specifically for membrane protein expression. Induction conditions must be optimized—lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) typically enhance proper folding over raw yield. For improved native conformation, gram-positive expression hosts like Bacillus subtilis or Lactococcus lactis may better accommodate the staphylococcal protein's folding requirements and post-translational modifications. Eukaryotic systems including yeast (P. pastoris) offer advantages for complex membrane proteins by providing a eukaryotic membrane environment and secretion machinery. Expression should be verified through Western blotting with antibodies specific to crcB2 or attached epitope tags, with functionality assessed through appropriate binding or activity assays.

What purification challenges are specific to crcB2, and how can researchers overcome them?

Purification of crcB2 presents several challenges inherent to membrane-associated bacterial proteins. First, solubilization requires careful detergent selection—mild non-ionic detergents like DDM or LMNG typically preserve structure better than harsher ionic detergents. Researchers should screen multiple detergents at various concentrations using thermal stability assays to identify optimal solubilization conditions. Second, protein aggregation during concentration steps can be mitigated by adding glycerol (5-10%) and maintaining protein solutions below critical micelle concentrations. Third, metal-affinity chromatography using histidine tags often yields co-purified contaminants; this necessitates secondary purification steps such as ion-exchange or size-exclusion chromatography. Fourth, tag removal can destabilize membrane proteins; consider leaving the tag intact if functional studies permit, or use cleavage-resistant spacers between the protein and tag. Finally, protein quality assessment is essential—use dynamic light scattering and analytical ultracentrifugation to verify monodispersity and absence of aggregation before proceeding to functional studies.

How can researchers design knockdown studies to examine crcB2 function in Staphylococcus saprophyticus?

Designing effective crcB2 knockdown studies in S. saprophyticus requires careful consideration of genetic manipulation techniques suitable for this species. Begin with antisense RNA approaches by designing complementary RNA sequences targeting crcB2 mRNA, expressed from an inducible promoter on a shuttle vector compatible with S. saprophyticus. CRISPR interference (CRISPRi) offers a more specific approach by using catalytically inactive Cas9 (dCas9) fused to a transcriptional repressor domain, guided to the crcB2 gene by specifically designed gRNAs. When genetic approaches prove challenging, morpholino oligonucleotides can provide transient knockdown through direct transfection. For any knockdown strategy, careful validation is essential through RT-qPCR to quantify mRNA reduction and Western blotting to confirm protein depletion. Phenotypic assessment should examine multiple parameters potentially affected by crcB2 reduction, including growth kinetics, biofilm formation capacity (quantified via crystal violet staining), and cellular morphology through electron microscopy—similar to approaches used when studying biofilm-associated genes in S. saprophyticus .

What evidence suggests a potential role for crcB2 in biofilm formation by Staphylococcus saprophyticus?

While direct evidence specifically linking crcB2 to biofilm formation is currently limited, several lines of investigation support this potential association. S. saprophyticus is known to form biofilms as a critical virulence determinant, with numerous cell surface and membrane proteins contributing to this process . Research on S. saprophyticus biofilms has revealed strain-specific variations in biofilm matrix composition between clinical and environmental isolates, suggesting differential expression and function of membrane-associated proteins in different ecological contexts . Comparative genomic analyses of S. saprophyticus have identified multiple genes involved in adhesion and biofilm formation that were acquired through horizontal gene transfer, suggesting that genes like crcB2 might similarly contribute to adaptive functions in specific niches . To investigate crcB2's potential role, researchers should employ gene knockout or knockdown approaches followed by quantitative biofilm assays and microscopic analysis of biofilm architecture, similar to methodologies used when characterizing the role of ica gene clusters in S. saprophyticus biofilm formation .

How does the expression of crcB2 potentially differ between commensal and pathogenic strains of Staphylococcus saprophyticus?

Expression patterns of crcB2 likely differ significantly between commensal and pathogenic S. saprophyticus strains, reflecting their distinct ecological adaptations. Research on S. saprophyticus has demonstrated that clinical and environmental isolates produce biofilms with distinctly different matrix compositions, suggesting differential expression of genes involved in cell surface interactions and adherence . Pathogenic strains typically upregulate virulence-associated genes in response to host environmental cues, which may include membrane proteins like crcB2 if they contribute to survival within the urinary tract. Researchers examining this question should employ RNA-seq or targeted RT-qPCR to quantify crcB2 expression across diverse strain collections under various conditions mimicking commensal (skin surface, nutrient limitation) versus pathogenic (urine, bladder cell co-culture) environments. Proteomic approaches using LC-MS/MS would complement transcriptomic data by confirming differential protein expression. Regulatory analysis examining promoter regions could identify strain-specific variations in transcription factor binding sites that might explain expression differences between lineages, similar to observations made regarding the lineage-specific distribution of regulatory genes like icaR in S. saprophyticus .

What methodological approaches can detect interactions between crcB2 and host immune components?

Investigating interactions between crcB2 and host immune components requires a systematic multi-method approach. Begin with biophysical interaction studies using surface plasmon resonance (SPR) or biolayer interferometry to screen purified recombinant crcB2 against individual host immune factors, including complement components, antimicrobial peptides, and pattern recognition receptors. Follow with co-immunoprecipitation assays using crcB2-specific antibodies in bacterial-host cell co-culture lysates to pull down potential interacting partners, identified subsequently by mass spectrometry. Cell-based assays measuring immune activation can detect functional consequences of these interactions—transfect human uroepithelial cells with crcB2 expression constructs and measure changes in cytokine production, NF-κB activation, or inflammasome assembly. In vivo models comparing wild-type and crcB2-deficient S. saprophyticus strains in murine UTI models would reveal differences in immune cell recruitment, cytokine profiles, and bacterial clearance rates. Finally, imaging techniques like FRET microscopy can visualize direct interactions in cellular contexts, providing spatial and temporal information about crcB2-host immune component associations.

How does crcB2 in Staphylococcus saprophyticus compare to homologous proteins in other staphylococcal species?

Comparative analysis of crcB2 across staphylococcal species reveals evolutionary patterns that inform both function and adaptation. Nucleotide sequence alignment analysis would likely show highest homology with closely related coagulase-negative staphylococci such as S. xylosus and S. equorum, which share approximately 80% average nucleotide identity with S. saprophyticus . Phylogenetic reconstruction based on multiple sequence alignments can reveal whether crcB2 evolution follows species evolution or shows evidence of horizontal gene transfer, similar to observations made for ica genes in S. saprophyticus . Domain architecture analysis through bioinformatic tools would identify conserved functional domains versus species-specific variations that might indicate specialized adaptations. Synteny analysis examining the genomic context of crcB2 across species can provide additional evolutionary insights, as gene neighborhood conservation often indicates functional relationships and co-evolution. For a comprehensive understanding, researchers should examine expression patterns of crcB2 homologs across different staphylococcal species under similar conditions, potentially revealing functional divergence despite sequence conservation.

What evidence suggests horizontal gene transfer versus vertical inheritance of crcB2 among staphylococcal species?

Distinguishing between horizontal gene transfer and vertical inheritance for crcB2 requires multiple lines of genomic evidence. GC content analysis provides initial clues—significantly different GC percentages compared to the core genome suggest foreign origin, as observed with icaC and icaR genes in S. saprophyticus (28.85% and 25.9% respectively versus the genome average) . Phylogenetic incongruence between crcB2 gene trees and species trees would strongly suggest horizontal transfer rather than vertical inheritance following speciation. Examining flanking regions for mobile genetic elements (insertion sequences, transposons) could reveal transfer mechanisms, similar to the SCC-mec-like structures observed flanking acquired ica clusters in some S. saprophyticus strains . Codon usage analysis comparing crcB2 with the core genome may reveal adaptation to different hosts if horizontally acquired. Distribution patterns across strains within the species are also informative—patchy distribution suggests multiple acquisition events rather than ancestral presence. Comprehensive analysis should include examination of homologs across the Staphylococcus genus to determine if gene distribution follows evolutionary relationships or shows evidence of cross-species transfer.

What bioinformatic tools and databases are most useful for analyzing the evolutionary history of crcB2?

For comprehensive evolutionary analysis of crcB2, researchers should utilize a strategic combination of specialized bioinformatic tools. Sequence retrieval and homology searching benefit from NCBI's BLAST suite and specialized databases including UniProt, RefSeq, and the Staphylococcal Genome Database for identifying orthologs across bacterial species. Multiple sequence alignment tools such as MUSCLE, T-Coffee, or MAFFT provide the foundation for evolutionary comparisons, with visualization through Jalview or AliView enhancing interpretation. Phylogenetic analysis should employ maximum likelihood methods (RAxML, IQ-TREE) and Bayesian inference (MrBayes) with appropriate evolutionary models selected via ModelTest or similar tools. For detecting horizontal gene transfer, specialized programs like IslandViewer, Alien_Hunter, or HGTector can identify signatures of foreign DNA acquisition. Synteny visualization tools including Mauve, SynteBase, or BRIG allow researchers to compare gene neighborhood conservation across species. Codon usage analysis via CodonW or GCUA can detect adaptation to different host backgrounds. For comprehensive functional prediction, integrate tools like InterProScan, SMART, CDD, and metagenomic databases to connect evolutionary patterns with functional implications.

What structural prediction methods best characterize the membrane topology of crcB2?

Accurate prediction of crcB2 membrane topology requires integration of multiple computational and experimental approaches. Begin with transmembrane prediction algorithms including TMHMM, Phobius, and MEMSAT, comparing outputs to establish consensus predictions of transmembrane helices and their orientations. Hydropathy analysis using Kyte-Doolittle or similar scales provides supporting evidence for membrane-spanning regions. For topology validation, PhoA/LacZ fusion experiments systematically fuse reporter enzymes at different positions within crcB2 and express in E. coli—PhoA is active only when located periplasically while LacZ functions in the cytoplasm, thus revealing protein orientation. Cysteine accessibility methods (SCAM) introduce cysteine residues at different positions followed by selective labeling with membrane-permeable or impermeable reagents to determine exposed regions. Cryo-electron microscopy of purified protein in nanodiscs or liposomes provides direct structural visualization. Integrating predictions with experimental validation creates a comprehensive topological map essential for understanding crcB2 function and developing targeted interventions for this potential virulence factor.

How can researchers identify potential protein-protein interactions involving crcB2 in Staphylococcus saprophyticus?

Identifying protein-protein interactions (PPIs) involving crcB2 requires a multi-faceted approach combining in vitro, in vivo, and computational methods. Initial screening via bacterial two-hybrid (B2H) systems specifically designed for membrane proteins would identify potential interaction partners by expressing crcB2 fused to one domain of a split transcription factor and a library of S. saprophyticus proteins fused to the complementary domain. For targeted PPI validation, co-immunoprecipitation using anti-crcB2 antibodies followed by mass spectrometry can identify native interaction partners in bacterial lysates. Bimolecular fluorescence complementation (BiFC) provides in vivo visualization by expressing crcB2 and candidate partners fused to complementary fragments of a fluorescent protein that reconstitute fluorescence when brought together by protein interaction. Surface plasmon resonance or microscale thermophoresis can quantify binding affinities between purified crcB2 and identified partners. Computational predictions using tools like STRING, InterPreTS, or specialized membrane protein interaction databases can guide experimental design by suggesting candidates based on co-evolution, gene neighborhood, or structural complementarity.

MethodApplication for crcB2AdvantagesLimitations
Bacterial Two-Hybrid (BACTH)Initial screening for interaction partnersWorks with membrane proteins, in vivo contextMay produce false positives, requires optimization
Co-immunoprecipitationValidation of native interactionsDetects physiological complexesRequires specific antibodies, transient interactions may be missed
Bimolecular Fluorescence ComplementationIn vivo visualizationSpatial information in bacterial cellsIrreversible complex formation may alter function
Crosslinking Mass SpectrometryMapping interaction domainsIdentifies specific contact pointsTechnically challenging, requires specialized equipment
Surface Plasmon ResonanceQuantitative binding analysisProvides kinetic and affinity dataRequires purified proteins, artificial environment

What experimental approaches can determine if crcB2 functions similarly to known CrcB proteins in other bacteria?

Determining functional similarity between S. saprophyticus crcB2 and CrcB proteins in other bacteria requires systematic functional comparison strategies. Complementation studies represent the gold standard approach—express crcB2 in CrcB-deficient strains of model organisms (E. coli, B. subtilis) and assess restoration of phenotypes, such as fluoride resistance, which is a known function of many bacterial CrcB proteins. Comparative physiology experiments should measure how crcB2 expression affects responses to various stressors (ionic stress, pH fluctuations, antimicrobials) compared to characterized CrcB proteins from other species. Electrophysiology techniques including patch-clamp or black lipid membrane assays can directly compare ion transport properties of purified crcB2 with other CrcB proteins reconstituted in artificial membranes or liposomes. Structure-function analysis through targeted mutagenesis of conserved residues across CrcB homologs would identify functionally essential amino acids shared between crcB2 and other family members. Heterologous expression studies examining subcellular localization patterns of fluorescently tagged crcB2 versus other CrcB proteins can reveal conserved trafficking and membrane integration mechanisms that suggest functional conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.