Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Overview and Molecular Characterization

CtaB is a membrane-associated enzyme encoded by the ctaB gene. In S. saprophyticus, recombinant CtaB (UniProt: Q49WP1) is produced via mammalian cell expression systems, ensuring post-translational modifications akin to native forms . Key features include:

  • Catalytic Role: Protoheme IX farnesyltransferase activity (EC 2.5.1.-), facilitating the attachment of a farnesyl group to protoheme IX to form heme O .

  • Structural Notes: Partial-length recombinant variants are commonly used for functional studies, retaining catalytic domains necessary for heme modification .

Functional Role in Heme Biosynthesis

CtaB operates within a conserved pathway shared across Staphylococcus species:

  1. Heme O Synthesis: CtaB transfers a farnesyl moiety to protoheme IX, forming heme O .

  2. Heme A Production: Heme O is subsequently oxidized by CtaA to heme A, a cofactor for cytochrome aa₃ and caa₃ oxidases .

  3. Respiratory Chain Link: These oxidases enable electron transport in aerobic respiration, impacting bacterial growth and metabolic efficiency .

In S. saprophyticus, heme biosynthesis intersects with virulence and environmental adaptation, though direct studies on CtaB remain limited compared to S. aureus .

Key Insights from Related Staphylococcal Studies

  • Virulence Attenuation: In S. aureus, ctaB deletion reduces virulence in murine models, linked to downregulated ribosomal and amino acid biosynthesis genes .

  • Pigment Production: CtaB-deficient S. aureus exhibits enhanced carotenoid pigment synthesis, suggesting metabolic trade-offs between respiration and secondary metabolite pathways .

  • Persister Cell Formation: ctaB mutants in MRSA show increased tolerance to quinolones, highlighting its role in antibiotic persistence .

Gaps in S. saprophyticus-Specific Research

While S. saprophyticus CtaB shares functional homology with S. aureus, its unique ecological niche (e.g., urinary tract colonization) warrants targeted studies . Current data emphasize:

  • Biofilm Independence: Unlike ica-dependent biofilms in S. aureus, S. saprophyticus biofilm matrices are protein- or eDNA-polysaccharide-based, with no direct link to CtaB .

  • Horizontal Gene Transfer: The ica cluster in S. saprophyticus is acquired from other staphylococci, suggesting evolutionary divergence in heme-related pathways .

Future Directions

  1. Structural Studies: Resolve full-length CtaB architecture to identify species-specific catalytic residues.

  2. Pathogenicity Links: Investigate CtaB’s role in S. saprophyticus urinary tract infections and biofilm modulation.

  3. Antimicrobial Targets: Explore CtaB inhibitors to disrupt heme-dependent respiration in antibiotic-resistant strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctaB; SSP1673; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
ctaB
Target Protein Sequence
MNKEQTLAHNSSRVTFKELQQIIKMGLVQGNLIPAFAGSWLAIVLANHSFLSSIPQILMM LVGSTLIMGGACALNNYYDQDIDSIMPSKQQRPTVNERISNRNLLILSFGMMLIGEALLF ALNIPSGVIGLLGIVGYVSFYSIWSKRHTVWNTVIGSFPGAVPPLIGWTAIEGNISLVAV ALFLVIFCWQPIHFYALAIKRKDEYSLANIPMLPSVKGFNRTRVSMFFWLVVLLPLPFLL SSLGVTFIVLATLLNLGWLYLGLTSFKKDTDQTKWATKMFIYSLNYLVVFFVLVVVISLI QMF
Uniprot No.

Target Background

Function

This recombinant Staphylococcus saprophyticus subsp. saprophyticus Protoheme IX farnesyltransferase (ctaB) converts heme B (protoheme IX) to heme O. This conversion involves the substitution of the vinyl group at carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.

Database Links

KEGG: ssp:SSP1673

STRING: 342451.SSP1673

Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is protoheme IX farnesyltransferase (ctaB) and what is its function in bacterial physiology?

Protoheme IX farnesyltransferase (ctaB) is an essential enzyme in bacterial respiratory systems that catalyzes the conversion of heme B (protoheme IX) to heme O by attaching a farnesyl group. This enzyme is critical for the synthesis of heme-containing terminal oxidases of the bacterial respiratory chain .

In Staphylococcus species, ctaB functions as a heme O synthase, facilitating electron transport processes essential for aerobic respiration. The enzyme is integral to energy production pathways and cellular metabolism. Without functional ctaB, bacteria experience significant alterations in their respiratory capacity, which affects numerous downstream physiological processes .

Assessment of ctaB functionality requires multiple complementary approaches:

  • Enzymatic activity assays: Measuring the conversion of protoheme IX to heme O using HPLC or spectrophotometric methods.

  • Respiratory chain function assessment: Oxygen consumption measurements using Clark-type electrodes to quantify electron transport chain efficiency.

  • Growth phenotype analysis: Comparing growth rates between wild-type and ctaB mutant strains under various oxygen conditions.

  • Complementation studies: Reintroducing functional ctaB genes into knockout mutants to verify phenotype restoration .

Sequence-based structural modeling using platforms like AlphaFold has also emerged as a valuable tool for studying ctaB structure-function relationships, with models available in repositories like RCSB PDB (AF_AFQ49WP1F1) .

What phenotypic changes occur in S. saprophyticus when ctaB is deleted?

Based on studies in related staphylococcal species, ctaB deletion produces several significant phenotypic alterations:

  • Impaired growth: Knockout mutants show attenuated growth rates, particularly under aerobic conditions.

  • Altered pigmentation: Studies in S. aureus demonstrate enhanced pigment production in ctaB mutants, suggesting metabolic compensation mechanisms.

  • Reduced virulence: Animal models show attenuated virulence in ctaB-deficient strains.

  • Increased persister cell formation: Notably, ctaB mutants exhibit enhanced formation of quinolone-tolerant persister cells in stationary phase.

  • Transcriptional changes: RNA-seq analysis reveals downregulation of virulence genes, including RNAIII, as well as decreased expression of ribosomal genes and amino acid biosynthesis pathways .

These findings suggest that ctaB plays multifaceted roles beyond electron transport, affecting regulatory networks involved in virulence and stress responses.

How does ctaB deletion affect biofilm formation in staphylococci?

While the exact mechanism varies between staphylococcal species, research suggests that respiratory chain deficiencies caused by ctaB deletion significantly impact biofilm dynamics:

  • In S. saprophyticus, biofilm composition appears distinct between environmental and clinical isolates, suggesting potential adaptation mechanisms related to respiration .

  • Biofilm production in S. saprophyticus is primarily ica-independent, contrasting with other staphylococcal species .

  • The altered metabolic state resulting from ctaB deletion likely influences the expression of surface adhesins and extracellular matrix components crucial for biofilm architecture.

  • Methodologically, researchers can evaluate these effects through:

    • Crystal violet biofilm quantification assays

    • Confocal laser scanning microscopy for biofilm architecture visualization

    • Transcriptomic analysis of biofilm-associated genes in wild-type versus ctaB mutants .

What evidence suggests ctaB has been under selective pressure during S. saprophyticus evolution?

Genomic analyses have revealed significant evolutionary patterns in S. saprophyticus:

  • Population genomic studies indicate substantial recombination in the S. saprophyticus genome, with approximately 70% of sites affected by recombination events .

  • Selective sweep analyses have identified regions with decreased nucleotide diversity (π) and Tajima's D, suggesting positive selection at specific loci .

  • While no selective sweep has been specifically documented for ctaB in S. saprophyticus, related genes involved in respiration and metabolism have shown evidence of selection.

  • The relative recombination rate (r/m) for S. saprophyticus is approximately 1.2, similar to S. aureus (~1), indicating moderate levels of horizontal gene transfer affecting genome evolution .

Methodologically, researchers employ various approaches to detect selection:

  • Sliding window analyses of diversity (π and Tajima's D)

  • FST calculations to identify allele frequency differences between ecological niches

  • Analysis of synonymous versus non-synonymous substitution rates

How does recombinant S. saprophyticus ctaB protein structure compare to orthologs in other bacterial species?

Structural comparisons reveal both conservation and divergence among ctaB proteins:

SpeciesSequence Identity to S. saprophyticus ctaBKey Structural/Functional DifferencesReference
S. aureus~80-85%Similar membrane topology and catalytic domains
C. diphtheriae~40-45%Divergent transmembrane organization
T. whipplei~35%Different substrate binding residues

The computed structure model from AlphaFold (AF_AFQ49WP1F1) indicates that S. saprophyticus ctaB has:

  • Multiple transmembrane regions characteristic of membrane-bound farnesyltransferases

  • A conserved catalytic core with high confidence score (pLDDT >90)

Understanding these structural similarities and differences is crucial for developing species-specific inhibitors or research tools.

What are the optimal procedures for purifying functional recombinant ctaB?

Purification of membrane proteins like ctaB requires specialized approaches:

  • Solubilization strategy:

    • Use mild detergents (DDM, LDAO, or CHAPS) to extract ctaB from membranes while maintaining protein folding and activity

    • Optimize detergent concentration through small-scale trials

  • Purification workflow:

    • Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Size exclusion chromatography for higher purity

    • Consider lipid nanodiscs for maintaining native-like membrane environment

  • Activity preservation:

    • Include appropriate cofactors (Mg²⁺, Mn²⁺)

    • Maintain reducing conditions with DTT or β-mercaptoethanol

    • Test activity at various steps of purification

For challenging membrane proteins like ctaB, researchers should consider detergent screening panels to identify optimal solubilization conditions that balance extraction efficiency with retained enzymatic activity.

How can researchers design effective ctaB knockout and complementation studies?

Successful genetic manipulation of S. saprophyticus ctaB requires:

  • Knockout strategy options:

    • Allelic replacement using temperature-sensitive plasmids

    • CRISPR-Cas9 based genome editing

    • Transposon mutagenesis for initial screens

  • Complementation approach:

    • Use of plasmids like pRB473 with appropriate promoters

    • Genomic reintegration for single-copy expression

    • Inducible expression systems to control complementation levels

  • Validation methods:

    • PCR verification of gene deletion/insertion

    • RT-qPCR to confirm transcriptional changes

    • Western blot to verify protein absence/presence

    • Phenotypic restoration testing

For example, a successful approach documented in S. aureus involved:

  • Fusion PCR to create deletion constructs

  • Plasmid pMX10 for gene replacement

  • Complementation using plasmid PRB473 with native promoters

  • Selection of transformants followed by phenotypic verification

What is the relationship between ctaB function and bacterial virulence in S. saprophyticus?

Evidence from studies in staphylococci suggests ctaB significantly impacts virulence through multiple mechanisms:

  • Toxin production regulation:

    • In S. aureus, ctaB mutation suppresses cytolytic toxin production

    • This appears mediated through repression of the Agr quorum sensing system

  • Animal model evidence:

    • ctaB knockout strains show attenuated virulence in mouse infection models

    • Decreased ability to establish systemic infection

  • Transcriptional effects:

    • RNA-seq analysis shows ctaB deletion causes decreased transcription of critical virulence genes

    • Includes downregulation of RNAIII, a master regulator of virulence

  • Metabolic adaptation:

    • The loss of electron transport functionality appears to induce feedback inhibition of metabolic capabilities

    • This suppression of TCA cycle activity, coupled with decreased RNAIII transcription, may prevent synthesis of virulence factors

These findings suggest ctaB could represent a novel target for anti-virulence strategies in staphylococcal infections.

How does ctaB contribute to antimicrobial persistence in S. saprophyticus?

Research has uncovered an unexpected relationship between ctaB function and antimicrobial persistence:

  • Enhanced persister formation:

    • Deletion of ctaB in staphylococci enhances formation of quinolone-tolerant persister cells

    • This effect is particularly pronounced in stationary phase cultures

  • Metabolic basis:

    • Disruption of electron transport chain function alters cellular energy status

    • Decreased energy availability may promote entry into dormant, antibiotic-tolerant states

  • Experimental assessment methods:

    • Time-kill experiments using 100× MIC antimicrobial exposure

    • CFU determination at multiple timepoints over extended periods (up to 7 days)

    • Comparison between exponential and stationary phase cultures

This connection between respiratory function and antimicrobial persistence highlights the complex relationship between bacterial metabolism and stress responses.

How does ctaB function in S. saprophyticus compare to its role in other pathogenic bacteria?

Comparative studies reveal both conserved and divergent aspects of ctaB function across bacterial species:

SpeciesPrimary ctaB FunctionUnique AspectsImplicationsReference
S. saprophyticusHeme O synthesis for respirationAssociated with urinary tract infection pathogenesisPotential adaptation for urinary tract environment
S. aureusHeme O synthesis; affects toxin productionImpacts Agr system; modulates persister formationCritical for virulence and antibiotic tolerance
C. diphtheriaeRespiratory chain componentPart of the pathogenesis systemEssential for growth and potentially toxin regulation

The conservation of ctaB across diverse pathogenic bacteria suggests its fundamental importance, while species-specific variations likely reflect adaptations to different host environments and pathogenic lifestyles.

What techniques are most effective for studying ctaB in different model systems?

Researchers employ diverse approaches depending on the bacterial species and research questions:

  • For bacterial genetics and physiology:

    • Allelic exchange mutagenesis (optimized for each species)

    • Complementation with species-specific vectors

    • Growth phenotyping under varying oxygen conditions

    • Membrane potential assessment using fluorescent probes

  • For host-pathogen interaction studies:

    • Cell culture infection models with ctaB mutants versus wild-type

    • Animal infection models (mouse, porcine) for in vivo relevance

    • Transcriptomic analysis of host response

  • For structural and biochemical investigations:

    • Heterologous expression optimized for membrane proteins

    • Activity assays with species-specific substrates

    • Computational structure prediction with experimental validation

When selecting methodologies, researchers should consider the specific challenges of working with membrane proteins and the particular characteristics of their bacterial model system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.