Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhC2 (mnhc2)
Description
Introduction to Cation/Proton Antiporters in Staphylococcus Species
Cation/proton antiporters represent a specialized class of membrane transport proteins that facilitate the exchange of cations (such as Na+ or K+) for protons (H+) across biological membranes. In Staphylococcus species, these antiporters serve critical functions in maintaining cytoplasmic pH homeostasis and enabling survival under extreme environmental stress conditions . The sophisticated transport mechanisms provided by these proteins allow bacteria to adapt to environments with varying salinity, pH levels, and other challenging factors.
Staphylococcus species possess multiple types of cation/proton antiporters, each with distinct structural features and functional capabilities. For instance, S. aureus harbors three types of cation/proton antiporters, with the type 3 family including two Na+/H+ (Mnh) antiporters, designated as Mnh1 and Mnh2 . These Mnh antiporters exist as clusters of seven hydrophobic membrane-bound protein subunits, forming complexes that span the cell membrane and facilitate ion exchange.
The significance of antiporter systems extends beyond basic physiological functions to influence bacterial virulence. Research on S. aureus has demonstrated that deletion of specific antiporter genes, particularly mnhA1, can substantially reduce virulence in mouse infection models, highlighting the potential connection between ion homeostasis mechanisms and pathogenicity .
The Mnh Antiporter Family in Staphylococcus
Different Mnh complexes demonstrate varying ion specificities and pH dependencies, suggesting evolutionary adaptations to diverse environmental niches. For example, the Mnh1 antiporter in S. aureus exhibits significant Na+/H+ exchange activity at pH 7.5, while Mnh2 shows capacity for both Na+/H+ and K+/H+ exchange, with optimal activity at pH 8.5 . These functional distinctions indicate that the two Mnh systems have evolved specialized roles to operate efficiently under different environmental conditions.
In S. saprophyticus, genomic analysis has revealed the presence of similar Mnh antiporter systems, which likely contribute to the remarkable halotolerance of this organism. This bacterium demonstrates the ability to survive and grow in media containing up to 20% NaCl, reflecting sophisticated adaptation mechanisms for osmotic stress management .
Structure and Characteristics of MnhC2 in S. saprophyticus
The putative antiporter subunit MnhC2 in S. saprophyticus constitutes one of the seven essential components of the Mnh2 antiporter complex. While specific structural information for this particular subunit is limited in the available literature, structural characteristics can be inferred from homologous proteins within the same family.
Based on comparative analysis with other members of the CPA3 family, MnhC2 is predicted to be an integral membrane protein featuring multiple transmembrane domains that anchor it within the cell membrane. By analogy with the MnhG2 subunit in S. saprophyticus, which contains multiple transmembrane helices arranged to span the membrane multiple times , MnhC2 likely adopts a similar topology with several membrane-spanning segments forming part of the ion translocation pathway.
The recombinant expression of MnhC2 typically involves fusion with affinity tags, such as polyhistidine (His) tags, to facilitate purification and subsequent applications . These engineered modifications preserve the functional integrity of the native protein while providing additional molecular features that enhance its utility in research contexts.
Table 1: Comparative Characteristics of Mnh Antiporter Subunits in Staphylococcus Species
Functional Role of MnhC2 in S. saprophyticus
Transcriptome analysis of S. saprophyticus under varying salt concentrations has revealed sophisticated adaptive responses involving multiple ion transport systems . Interestingly, while many bacteria upregulate the expression of Na+ antiporters and K+ transporters as a primary strategy for salt homeostasis, S. saprophyticus demonstrates downregulation of these genes at high salt concentrations . This counterintuitive response suggests that S. saprophyticus may employ alternative strategies for osmotic balance, potentially shifting from ion exchange mechanisms to compatible solute accumulation as environmental salinity increases.
The downregulation of genes encoding betaine/carnitine/choline transporter (BCCT) family proteins at high salt concentrations further supports this hypothesis . Instead, S. saprophyticus appears to upregulate genes involved in the synthesis of compatible solutes such as glutamate, which may serve as the primary osmoprotectant in this organism under extreme salt stress.
Recombinant Expression and Purification Methods
For bacterial antiporter subunits, Escherichia coli often serves as the preferred expression host due to its simplicity, rapid growth, and high protein yield potential. Recombinant MnhC2 is typically expressed with affinity tags, such as polyhistidine (His) tags, to facilitate downstream purification processes . These tags can be strategically positioned at either the N-terminus or C-terminus of the protein to minimize interference with protein folding and function.
The purification process for recombinant MnhC2 generally involves several steps:
-
Cell lysis to release the membrane-bound protein
-
Membrane fraction isolation through differential centrifugation
-
Solubilization of membrane proteins using appropriate detergents
-
Affinity chromatography utilizing the engineered tag
-
Size exclusion chromatography for final purification
The purified recombinant MnhC2 can then be utilized for various research applications, including structural studies, functional assays, and development of targeted inhibitors.
Expression Patterns Under Salt Stress
Transcriptome analysis of S. saprophyticus under different salt concentrations has provided valuable insights into the expression patterns of various transporters and stress response proteins. While specific information regarding MnhC2 expression is not explicitly detailed in the available literature, general patterns observed for ion transporters can inform our understanding of how the Mnh2 complex may be regulated under salt stress.
Table 2: Differential Expression of Transporter Genes in S. saprophyticus Under Salt Stress
The downregulation of most ion transporters, including Na+ antiporters and K+ transporters, under high salt conditions suggests that S. saprophyticus may shift from a "salt-in" strategy to a "compatible solutes" strategy as environmental salinity increases . This adaptation may involve changes in the expression and activity of the Mnh2 complex, including the MnhC2 subunit, as part of a coordinated response to extreme osmotic stress.
Comparative Analysis with Other Staphylococcus Species
Comparing the antiporter systems across different Staphylococcus species provides valuable context for understanding the specific adaptations of S. saprophyticus. While S. aureus and S. saprophyticus both possess Mnh antiporter complexes, their utilization and regulation appear to differ in response to environmental stressors.
In S. aureus, the Mnh1 antiporter plays a significant role in maintaining halotolerance at neutral pH (around 7.5), while the Mnh2 antiporter contributes to both osmotolerance and halotolerance, particularly at more alkaline pH values (around 8.5) . Deletion of the mnhA1 gene in S. aureus results in a significant reduction in growth rate under elevated salt conditions, particularly in the pH range of 7.5 to 9.0 . Furthermore, deletion of mnhA1 leads to a major loss of virulence in mouse infection models, highlighting the connection between salt tolerance mechanisms and pathogenicity .
In contrast, S. saprophyticus appears to employ different molecular strategies for halotolerance, with transcriptome data suggesting a greater emphasis on compatible solute accumulation rather than ion exchange under extreme salt stress . This difference may reflect the ecological niches occupied by these bacteria, with S. saprophyticus commonly found in environments with fluctuating osmolarity, such as food fermentation processes and the urinary tract.
Research Applications and Future Directions
Recombinant S. saprophyticus MnhC2 protein has significant potential for various research applications. As a component of a multisubunit antiporter complex involved in salt tolerance, MnhC2 represents a valuable target for studies focusing on bacterial adaptation to extreme environments.
Potential research applications include:
-
Structural studies to elucidate the three-dimensional conformation and membrane topology of MnhC2
-
Functional characterization of ion transport activities and substrate specificities
-
Investigation of protein-protein interactions within the Mnh2 complex
-
Development of targeted inhibitors that could potentially disrupt salt tolerance mechanisms
Future research directions should focus on:
As our understanding of bacterial ion transport mechanisms continues to evolve, recombinant proteins like MnhC2 provide valuable tools for advancing our knowledge of fundamental cellular processes and potentially identifying new targets for antimicrobial interventions.
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: ssp:SSP2094
STRING: 342451.SSP2094
Q&A
What is the MnhC2 protein and what is its primary function in Staphylococcus saprophyticus?
MnhC2 is a putative antiporter subunit that likely functions as part of a multisubunit Na+/H+ antiporter complex in Staphylococcus saprophyticus. Based on studies of homologous proteins in related species such as S. aureus, MnhC2 (also known as MrpC2) appears to be involved in ion exchange across cell membranes, particularly Na+/H+ exchange, which is critical for bacterial pH homeostasis and salt tolerance. The protein is believed to be one component of a larger complex that facilitates ion transport across bacterial membranes, contributing to the organism's ability to survive in various environmental conditions .
How does the amino acid sequence of S. saprophyticus MnhC2 compare to homologous proteins in other Staphylococcus species?
While the specific sequence of S. saprophyticus MnhC2 is not provided in the search results, we can infer from related research that it likely shares significant homology with the S. aureus version. The S. aureus MnhC2 protein consists of 114 amino acids with the sequence: MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK . Researchers studying this protein should perform sequence alignment analyses using tools like BLAST to determine the degree of conservation between species, which would inform functional predictions and evolutionary relationships among these antiporter subunits.
What experimental evidence supports the classification of MnhC2 as an antiporter subunit?
The classification of MnhC2 as an antiporter subunit is supported by functional studies of related proteins in S. aureus, where Na+/H+ antiport activity was detected in membrane vesicles prepared from cells expressing the putative antiporter genes. These studies showed that cells harboring plasmids for the cloned genes were able to grow in medium containing high salt concentrations (0.2 M NaCl or 10 mM LiCl), while host cells without the plasmids failed to grow under the same conditions . This functional evidence, combined with sequence analysis and structural predictions, provides the basis for classifying MnhC2 as part of an antiporter complex.
What are the optimal conditions for expressing recombinant MnhC2 protein in laboratory settings?
For optimal expression of recombinant MnhC2 protein, E. coli expression systems have proven effective for related proteins. Based on protocols for similar antiporter subunits, the following conditions are recommended:
-
Expression vector: Choose a vector with a strong promoter (T7 or tac) and appropriate tag (His-tag is commonly used for purification)
-
Expression host: E. coli BL21(DE3) or similar strain optimized for membrane protein expression
-
Growth conditions: Culture at 30°C rather than 37°C to reduce inclusion body formation
-
Induction: Use lower IPTG concentrations (0.1-0.5 mM) and longer induction times (4-6 hours)
-
Buffer composition: Include glycerol (6-50%) in storage buffers to maintain protein stability
The recombinant protein should be stored in a Tris/PBS-based buffer with pH 8.0 and 6% trehalose to maintain stability. For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C/-80°C is recommended .
How should researchers design experiments to measure the antiporter activity of MnhC2?
To measure the antiporter activity of MnhC2, researchers should follow these methodological steps:
-
Prepare everted membrane vesicles from cells expressing the recombinant MnhC2 protein
-
Establish a pH gradient across the membrane using an appropriate buffer system
-
Measure ion exchange (Na+/H+ or Li+/H+) using fluorescent probes or radioisotopes
-
Test activity across a range of pH values (optimally pH 7.0-7.5 based on studies of related proteins)
-
Include appropriate controls (vesicles from cells not expressing MnhC2)
When designing these experiments, it's important to note that unlike some other bacterial Na+/H+ antiporters (such as NhaA from E. coli), the antiporter complexes containing MnhC2 typically show maximum activity at pH 7.0-7.5 rather than at more alkaline pH values . This pH profile distinction is crucial for accurate activity measurement and functional characterization.
What variables should be controlled in experimental designs studying MnhC2 function?
When studying MnhC2 function, researchers should control the following variables to ensure reliable and reproducible results:
| Variable | Control Method | Importance |
|---|---|---|
| pH | Use consistent buffer systems; test activity across pH range 6.5-8.5 | Critical for antiporter activity assessment |
| Ion concentrations | Standardize Na+, Li+, and other ion concentrations | Affects substrate availability and activity measurements |
| Temperature | Maintain consistent temperature during assays (typically 25-30°C) | Influences protein stability and activity |
| Membrane preparation | Standardize vesicle preparation protocols | Ensures comparable protein incorporation and orientation |
| Expression levels | Quantify protein expression by western blot | Controls for variation in protein abundance |
| Host cell background | Use appropriate control strains lacking endogenous antiporters | Eliminates background activity from host proteins |
Controlling these variables is essential for establishing causality in experimental design experiments, as explained in general experimental design principles . For MnhC2 specifically, careful control of pH and ion concentrations is particularly important given the protein's role in ion exchange.
How does the structure-function relationship of MnhC2 contribute to ion selectivity in the multisubunit antiporter complex?
The structure-function relationship of MnhC2 and its contribution to ion selectivity remains an area requiring further research. Based on studies of related antiporter subunits, MnhC2 likely contains multiple transmembrane domains that form part of the ion transport pathway. The amino acid sequence of related proteins, such as S. aureus MnhC2, suggests a hydrophobic protein with transmembrane regions that may contribute to the formation of ion-binding sites or transport channels .
To investigate this relationship, researchers should consider:
-
Performing site-directed mutagenesis of conserved residues to identify those critical for ion binding and transport
-
Utilizing molecular modeling approaches based on the known structures of related transporters
-
Applying biophysical techniques such as circular dichroism or nuclear magnetic resonance to examine structural changes upon ion binding
-
Conducting ion competition studies to determine selectivity patterns (Na+ vs. Li+ vs. K+)
Understanding these structure-function relationships could provide insights into how the multisubunit complex achieves ion selectivity and directional transport across membranes.
What is the phylogenetic relationship of MnhC2 across different Staphylococcus species and how has it evolved?
Phylogenetic analysis of antiporter subunits in other systems has revealed interesting evolutionary patterns. For example, in studies of hemocyanin subunits (which are not directly related but provide a methodological template), researchers found that MnHc-1 and MnHc-2 belong to separate clades, with MnHc-1 belonging to the gamma subunit that has evolved distinctly .
For MnhC2 in Staphylococcus species, researchers should:
-
Collect homologous sequences from multiple Staphylococcus species and related genera
-
Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL
-
Construct phylogenetic trees using maximum likelihood or Bayesian methods
-
Analyze rates of evolution and selection pressures on different protein domains
This phylogenetic analysis would provide insights into the conservation of MnhC2 function across species and identify regions under selective pressure, which could correspond to functionally important domains.
How do transcriptional and post-translational modifications regulate MnhC2 expression and function under different environmental conditions?
Regulation of antiporter subunits often responds to environmental stressors, particularly changes in pH and salt concentration. Based on studies of related proteins, researchers investigating MnhC2 regulation should examine:
-
Transcriptional regulation: Identify promoter elements and transcription factors that control mnhC2 expression under various conditions
-
Environmental induction: Measure mRNA expression levels in response to salt stress, pH changes, and other environmental variables
-
Post-translational modifications: Investigate potential phosphorylation, acetylation, or other modifications that might modulate protein function
-
Protein-protein interactions: Examine how MnhC2 interacts with other subunits of the antiporter complex under different conditions
Studies in other systems have shown that expression of transport proteins can be significantly affected by environmental conditions. For example, in Oriental River Prawn, hemocyanin subunit expression was significantly altered by bacterial infection, with downregulation at 3 hours post-infection followed by upregulation at 6-12 hours . Similar time-course studies for MnhC2 would provide valuable insights into its regulation during stress responses.
What are the main challenges in purifying functional MnhC2 protein and how can they be overcome?
Purification of functional membrane proteins like MnhC2 presents several challenges. Based on protocols for similar proteins, researchers should consider the following strategies:
-
Solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at optimized concentrations to extract MnhC2 from membranes without denaturation
-
Affinity purification: Utilize His-tagged constructs for initial purification via nickel affinity chromatography
-
Buffer optimization: Include stabilizing agents such as glycerol, trehalose, or specific lipids in purification buffers
-
Size exclusion chromatography: Perform final purification steps using size exclusion to separate properly folded protein from aggregates
-
Functional validation: Confirm protein activity following each purification step to ensure functionality is maintained
For recombinant MnhC2 protein, reconstitution into proteoliposomes after purification may be necessary to properly assess antiporter activity, as the protein requires a lipid bilayer environment for proper function .
How can researchers effectively study MnhC2 interactions with other subunits in the multisubunit antiporter complex?
Studying protein-protein interactions within multisubunit complexes requires specialized approaches. For MnhC2, researchers should consider:
-
Co-immunoprecipitation: Using antibodies against MnhC2 or other subunits to pull down interaction partners
-
Bacterial two-hybrid systems: Adapted for membrane proteins to detect binary interactions
-
Cross-linking mass spectrometry: To identify interaction interfaces between subunits
-
Blue native PAGE: To preserve native complexes during separation
-
Förster resonance energy transfer (FRET): To study interactions in live cells when possible
Research on the Na+/H+ antiporter from S. aureus revealed that seven ORFs were necessary for antiporter function, indicating a complex multisubunit structure where all components are required for activity . Similar complexity should be anticipated when studying MnhC2 interactions in S. saprophyticus.
What are the most effective approaches for analyzing the role of MnhC2 in bacterial stress response and pathogenicity?
To investigate MnhC2's role in stress response and potential contributions to pathogenicity, researchers should implement:
-
Gene knockout/knockdown studies: Generate mnhC2-deficient mutants and assess phenotypic changes under various stress conditions
-
Complementation assays: Reintroduce wild-type and mutant versions of mnhC2 to confirm phenotype specificity
-
Stress tolerance assays: Measure growth in media with varying pH, salt concentrations, and antimicrobial compounds
-
Virulence models: Assess the impact of mnhC2 disruption on virulence in appropriate infection models
-
Transcriptomic analysis: Profile gene expression changes in response to mnhC2 manipulation
Studies of S. aureus antiporter genes showed that cells expressing these genes could grow in high salt conditions while control cells could not , suggesting a role in osmotic stress tolerance. Similar approaches could elucidate the specific contributions of MnhC2 to stress response in S. saprophyticus.
How might structural biology approaches advance our understanding of MnhC2 function in ion transport?
Advanced structural biology techniques could significantly enhance our understanding of MnhC2 by:
These structural approaches, combined with functional studies, would provide a comprehensive view of how MnhC2 contributes to ion transport mechanics within the larger antiporter complex.
What novel experimental techniques could improve the study of ion transport kinetics in MnhC2-containing antiporter complexes?
Emerging techniques for studying transport kinetics include:
-
Solid-supported membrane electrophysiology: Allowing direct measurement of charge movement during transport cycles
-
Single-molecule fluorescence microscopy: Visualizing individual transport events
-
Nanodiscs technology: Providing a more native-like membrane environment for functional studies
-
Microfluidic platforms: Enabling rapid screening of transport activity under various conditions
-
Time-resolved structural techniques: Capturing intermediates in the transport cycle
These advanced methodologies would provide more detailed insights into the kinetic parameters of ion transport, including rate-limiting steps and the effects of mutations on transport efficiency.
How could systems biology approaches integrate MnhC2 function into broader cellular ion homeostasis networks?
Systems biology approaches can contextualize MnhC2 function within the broader cellular machinery by:
-
Metabolic flux analysis: Measuring how MnhC2 activity affects broader cellular energetics
-
Integrative modeling: Combining proteomic, transcriptomic, and metabolomic data to build comprehensive models of ion homeostasis
-
Network analysis: Identifying other components that interact with or are regulated alongside MnhC2
-
Synthetic biology approaches: Reconstructing minimal ion homeostasis systems to test hypotheses about component interactions
-
Multi-omics studies: Integrating data across system levels to understand emergent properties
These approaches would help transition from understanding individual proteins to comprehending how entire systems cooperate to maintain ion balance under various environmental conditions.
