Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhE2 (mnhE2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mnhE2; mrpE2; SSP2092; Putative antiporter subunit mnhE2; Mrp complex subunit E2; Putative NADH-ubiquinone oxidoreductase subunit mnhE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
mnhE2
Target Protein Sequence
MRQVLLNIVIAFLWVLFQDEDSFKLSTFFAGYLIGILVIYILHRFFGQQFYLKKVWVGIK FLAVYLYQLITSSMTIINYILFKTKDLNPGLVTYETTLDNDWEVTFLTILIIITPGSTVI RISKEKKKFFIHAIDVSDKEKQKLLKSIRQYEGLILEVAE
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP2092

STRING: 342451.SSP2092

Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MnhE2 antiporter subunit in Staphylococcus saprophyticus?

MnhE2 is a component of the Mnh2 antiporter complex in Staphylococcus saprophyticus, functioning as part of a cation/proton exchange system. Similar to the well-characterized systems in S. aureus, the Mnh2 antiporter in S. saprophyticus likely plays a crucial role in ion homeostasis. The MnhE2 subunit is one of the seven proteins that form the complete Mnh2 multisubunit complex, which generally facilitates the exchange of monovalent cations (Na+ or K+) for protons across the cell membrane . This protein is 160 amino acids in length and is commercially available as a His-tagged recombinant protein for research purposes .

How does MnhE2 differ from MnhE1 in staphylococcal species?

MnhE2 and MnhE1 are subunits of different antiporter complexes (Mnh2 and Mnh1, respectively) that show distinct regulation patterns. Based on findings in related staphylococcal species, Mnh1 (including MnhE1) is largely constitutively expressed, maintaining relatively stable expression levels regardless of environmental conditions. In contrast, Mnh2 (including MnhE2) is often regulated by the stress-responsive sigma factor σB and is upregulated under stressful conditions . This differential regulation suggests these antiporters serve complementary but distinct physiological roles, with MnhE2 potentially being more important during environmental stress adaptation.

What is the genomic organization of the mnh2 operon?

The mnh2 operon in staphylococcal species typically contains seven mnhA2-G2 genes encoding the multisubunit antiporter complex. Unlike the mnh1 operon, which consists solely of the seven antiporter genes, the mnh2 operon is often preceded by an integrase-recombinase gene (itr). In S. aureus, it has been observed that the mnh operons are transcribed in different directions from different loci in the chromosome . This organization may be similar in S. saprophyticus, although specific studies on the mnhE2 gene arrangement in this species would be needed for confirmation.

What role does MnhE2 play in salt tolerance of Staphylococcus saprophyticus?

The MnhE2 subunit, as part of the Mnh2 antiporter, likely contributes significantly to salt tolerance in S. saprophyticus, particularly in high-salt environments. Transcriptome studies of halotolerant S. saprophyticus have shown that genes encoding Na+ antiporters and K+ transporters involved in salt homeostasis have altered expression patterns under salt stress . The activity of these antiporters appears to be part of the primary strategy for salt homeostasis in staphylococci. Research methodologies to investigate this function should include:

  • Growth curve analyses in media with increasing NaCl concentrations

  • Ion transport assays measuring Na+/H+ and K+/H+ antiport activity

  • Gene expression studies under varying salt concentrations

  • Construction of mnhE2 deletion mutants and complementation strains

  • Measurement of intracellular ion concentrations in wild-type versus mutant strains

Studies in related S. aureus have shown that mnh2 deletion mutants exhibit increased sensitivity to high potassium concentrations, especially at elevated pH, suggesting a similar role may exist for the S. saprophyticus Mnh2 complex .

How do recombination patterns affect the evolution of mnhE2 in different S. saprophyticus clades?

ParameterClade 1Clade 2Significance
r/m valueLower3× higher than Clade 1Indicates different evolutionary mechanisms
Recombinant fragment lengthShorterSignificantly longerAffects potential for gene acquisition
Recombinant fragment frequencyLowerHigherImpacts genetic diversity
Inter-clade recombinationVery rareVery rareSuggests reproductive isolation

These differences suggest that mnhE2 may evolve differently in each clade, potentially adapting to distinct ecological niches. The rare inter-clade recombination events indicate barriers to horizontal gene transfer that may include restriction-modification systems . To study this evolution, researchers should employ comparative genomics approaches examining mnhE2 sequence variation across multiple isolates from different ecological sources.

What are the optimal conditions for expressing recombinant MnhE2 protein?

For successful expression of functional recombinant MnhE2 protein, researchers should consider the following methodological approaches:

  • Expression system selection:

    • E. coli BL21(DE3) for high-yield cytoplasmic expression

    • Membrane protein expression systems (C41/C43) for maintaining native conformation

    • Cell-free expression systems for potentially toxic membrane proteins

  • Expression conditions:

    • Induction at lower temperatures (16-25°C) to enhance proper folding

    • Use of mild inducers (0.1-0.5 mM IPTG) to prevent inclusion body formation

    • Extended expression time (16-24 hours) at reduced temperatures

  • Solubilization and purification:

    • Mild detergents (DDM, LDAO) for membrane protein extraction

    • Nickel affinity chromatography for His-tagged proteins

    • Size exclusion chromatography for final purification

  • Functional validation:

    • Reconstitution into proteoliposomes for transport assays

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to assess protein stability

For activity studies, the protein should be reconstituted into liposomes with appropriate lipid composition mimicking staphylococcal membranes, and ion transport can be measured using fluorescent probes or radioactive isotopes.

How can functional assays be designed to measure MnhE2 antiporter activity?

To effectively measure the antiporter activity associated with MnhE2 as part of the Mnh2 complex, the following methodological approaches are recommended:

  • Everted membrane vesicle assays:

    • Prepare inside-out membrane vesicles from cells expressing the complete Mnh2 complex

    • Load vesicles with fluorescent pH indicators (ACMA, pyranine)

    • Monitor fluorescence changes upon addition of Na+ or K+ to measure H+ antiport

  • Proteoliposome-based assays:

    • Reconstitute purified Mnh2 complex into liposomes

    • Establish pH gradient across the liposome membrane

    • Measure cation uptake using isotopes (22Na+, 86Rb+ as K+ analog) or fluorescent indicators

  • Whole-cell assays:

    • Use mnhE2 deletion mutants complemented with wild-type or modified mnhE2

    • Load cells with pH-sensitive or ion-sensitive fluorescent dyes

    • Monitor changes in intracellular pH or ion concentrations in response to extracellular ion changes

  • Patch-clamp electrophysiology:

    • For detailed kinetic and mechanistic studies

    • Allows direct measurement of ion currents across membranes

    • Can determine ion selectivity and transport rates

These functional assays should be performed under varying pH conditions (pH 6.5-8.5) and different ion concentrations to determine the optimal activity conditions and substrate preferences of the MnhE2-containing antiporter complex.

How should researchers interpret phenotypic differences between mnhE2 mutants and wild-type S. saprophyticus?

When analyzing phenotypic differences between mnhE2 mutants and wild-type strains, researchers should consider a systematic approach:

  • Growth characteristics analysis:

    • Compare growth rates under standard conditions and various stresses

    • Assess colony morphology and pigmentation changes

    • Examine biofilm formation capabilities

  • Physiological parameter assessment:

    • Measure intracellular pH homeostasis under acid/alkaline stress

    • Determine intracellular Na+ and K+ concentrations

    • Evaluate membrane potential and proton motive force

  • Stress response evaluation:

    • Test survival under osmotic shock conditions

    • Assess resistance to antimicrobial compounds

    • Measure expression of stress-response genes

  • Potential confounding factors:

    • Compensatory upregulation of other transporters

    • Pleiotropic effects due to disruption of ion homeostasis

    • Secondary mutations that may arise during mutant construction

Based on studies in S. aureus, researchers might observe increased pigmentation in mnhE2 mutants as part of a stress response, similar to the hyperpigmentation seen in mnhA1 mutants . Changes in colony size or morphology may also indicate altered cellular physiology resulting from disrupted ion homeostasis.

What comparative genomic approaches are useful for studying mnhE2 evolution across staphylococcal species?

To effectively study mnhE2 evolution across staphylococcal species, researchers should employ these comparative genomic approaches:

  • Phylogenetic analysis:

    • Construct maximum-likelihood trees of mnhE2 sequences

    • Compare with species phylogeny to detect horizontal gene transfer

    • Calculate selection pressures (dN/dS ratios) acting on different domains

  • Recombination detection:

    • Use methods like ClonalFrameML to identify recombinant fragments

    • Calculate r/m ratios to determine the relative impact of recombination versus mutation

    • Apply FastGear to detect horizontal gene transfer between different clades or species

  • Synteny analysis:

    • Compare genomic organization of mnh operons across species

    • Identify conserved gene neighborhoods and operonic structures

    • Detect insertion/deletion events and genomic rearrangements

  • Regulatory element analysis:

    • Identify promoter regions and transcription factor binding sites

    • Compare σB-dependent regulation across species

    • Analyze expression patterns using transcriptomic data from public databases

Given that S. saprophyticus has distinct clades with different recombination patterns and apparent barriers to horizontal gene transfer, researchers should pay particular attention to clade-specific variations in mnhE2 and associated genes . The differences in restriction-modification systems between clades may provide insights into the evolutionary trajectories of mnhE2.

What are promising approaches for targeting MnhE2 in antimicrobial development?

Given the importance of ion homeostasis for bacterial survival, targeting MnhE2 and the Mnh2 antiporter complex represents a potential strategy for antimicrobial development. Promising research approaches include:

  • Structure-based drug design:

    • Determine the three-dimensional structure of MnhE2 using X-ray crystallography or cryo-EM

    • Identify binding pockets suitable for small molecule inhibitors

    • Perform in silico screening of compound libraries against identified targets

  • High-throughput screening:

    • Develop fluorescence-based assays suitable for screening compound libraries

    • Screen for molecules that inhibit ion transport or protein-protein interactions within the complex

    • Validate hits using secondary assays for specificity and mechanism of action

  • Peptide inhibitor development:

    • Design peptides mimicking essential interfaces between subunits

    • Test competitive inhibition of complex assembly

    • Optimize peptides for stability and cellular penetration

  • Combination approaches:

    • Identify synergistic effects between Mnh inhibitors and existing antibiotics

    • Target multiple ion transport systems simultaneously

    • Explore potentiators that enhance antibiotic efficacy through disruption of ion homeostasis

Evidence from S. aureus studies indicates that Mnh1 is required for fitness and pathogenesis in vivo , suggesting that targeting these antiporter systems could potentially attenuate virulence or enhance susceptibility to other antimicrobials.

How might environmental adaptations influence MnhE2 function in different S. saprophyticus isolates?

S. saprophyticus isolates from different ecological niches may exhibit variations in MnhE2 function related to specific environmental adaptations. Research approaches to investigate this include:

  • Comparative functional analysis:

    • Isolate S. saprophyticus from diverse environments (clinical, food, environmental sources)

    • Sequence and compare mnhE2 alleles from different isolates

    • Express and functionally characterize variants in standardized systems

  • Environmental stress adaptation studies:

    • Examine mnhE2 expression under conditions mimicking different ecological niches

    • Assess the contribution of MnhE2 to survival under niche-specific stresses

    • Determine if regulatory patterns differ between isolates from different sources

  • Host adaptation analysis:

    • Compare isolates from different host species (human, animal)

    • Assess whether host-specific adaptations exist in MnhE2 function

    • Determine if virulence potential correlates with specific MnhE2 variants

  • Evolutionary rate analysis:

    • Calculate evolutionary rates of mnhE2 in different lineages

    • Identify positions under positive selection

    • Correlate with ecological or host adaptations

Given that S. saprophyticus has genetically distinct clades with differences in metabolic capacity , researchers should investigate whether these differences extend to ion transport systems like MnhE2, potentially explaining adaptation to different niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.