Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhF2 (mnhF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhF2; mrpF2; SSP2091; Putative antiporter subunit mnhF2; Mrp complex subunit F2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
mnhF2
Target Protein Sequence
MIGTLTDFFITSALILFGIALLLTLFRLIKGPTTADRVVTFDAASAILMSMVGLLSIVFG TFSFLDSILLIAIISFVSTVSISRFIEGGHVFNANNKRNR
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP2091

STRING: 342451.SSP2091

Protein Families
CPA3 antiporters (TC 2.A.63) subunit F family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of mnhF2 in S. saprophyticus adaptation to multiple environments?

The putative antiporter subunit mnhF2 likely plays a role in S. saprophyticus' remarkable adaptability across diverse environments including soil, freshwater, food products, and mammalian hosts . As a membrane transporter, mnhF2 would contribute to maintaining ionic homeostasis across different environmental conditions. The genomic evidence shows S. saprophyticus functions as a bacterial generalist, with isolates from different niches being genetically similar . This suggests that membrane transporters like mnhF2 may have evolved to function efficiently across varying pH levels, osmotic conditions, and nutrient availabilities encountered in these diverse environments.

Methodologically, researchers should approach this question through comparative genomics of mnhF2 sequence conservation across isolates from different environments, coupled with expression studies under varying environmental conditions to assess functional adaptability.

How does clade structure in S. saprophyticus populations influence mnhF2 genetic diversity?

Current research indicates S. saprophyticus has two major clades that are genetically distinct with barriers to horizontal gene transfer between them . Clade 2 demonstrates approximately three times higher recombination rates than Clade 1, which could affect the genetic diversity of membrane proteins like mnhF2 .

When studying mnhF2, researchers should determine which clade their isolates belong to and consider that:

  • Sequence variations in mnhF2 may correlate with clade structure

  • Functional differences in the antiporter might exist between clades

  • Recombination events affecting mnhF2 likely occur primarily within clades rather than between them

For methodological approaches, researchers should perform phylogenetic analyses to place their isolates within the population structure before conducting functional studies of mnhF2.

What role might mnhF2 play in S. saprophyticus pathogenesis in different host environments?

S. saprophyticus causes both urinary tract infections in humans and mastitis in cattle . Membrane transporters like mnhF2 could be involved in adaptation to these distinct host environments by:

  • Maintaining ion homeostasis under host-specific challenges

  • Contributing to resistance against host antimicrobial peptides

  • Supporting metabolic adaptation to host-specific nutrient conditions

Research approaches should include comparative expression studies of mnhF2 in colonization models mimicking both human urinary tract and bovine mammary tissue, and phenotypic characterization of mnhF2 knockout mutants in both infection models.

How do restriction-modification systems in S. saprophyticus affect recombinant expression of mnhF2?

The genomic analyses reveal differences in restriction-modification systems (RMS) between the two major clades of S. saprophyticus . These systems serve as bacterial immune mechanisms by eliminating foreign DNA based on methylation patterns. When working with recombinant mnhF2:

  • Researchers must consider host compatibility between expression systems and S. saprophyticus RMS

  • Expression vectors may require specific methylation patterns to avoid degradation

  • Clade-specific RMS differences may necessitate different cloning strategies depending on the source isolate

Methodologically, researchers should:

  • Identify the RMS present in their specific S. saprophyticus isolate

  • Select appropriate host strains that complement these RMS patterns

  • Consider using methylation-deficient hosts for initial cloning steps

  • Employ electroporation protocols optimized for Staphylococcus species

What is the relationship between mnhF2 function and metabolic adaptation in different S. saprophyticus ecological niches?

The research indicates metabolic differences between the two major clades of S. saprophyticus, which may contribute to their ecological differentiation . As a putative antiporter, mnhF2 likely influences cellular bioenergetics and metabolism by:

  • Maintaining proton motive force necessary for ATP synthesis

  • Regulating intracellular pH in response to environmental acids or bases

  • Facilitating transport of metabolites or ions essential for niche-specific metabolism

CladeRecombination RateMetabolic CharacteristicsPotential mnhF2 Adaptations
Clade 1Lower (r/m baseline)Potentially adapted to different carbon sourcesMay show adaptations for specific ion environments
Clade 2Higher (3x r/m)Shows metabolic differences from Clade 1May have greater sequence diversity due to higher recombination

Researchers should approach this question through metabolomic analysis coupled with mnhF2 expression studies under varying growth conditions representative of different ecological niches.

How does horizontal gene transfer affect the evolution of mnhF2 compared to other membrane proteins in S. saprophyticus?

The genomic data indicates that horizontal gene transfer (HGT) is relatively limited in S. saprophyticus compared to other bacterial generalists, with an r/m value of 1.2, similar to S. aureus but much lower than Campylobacter jejuni (r/m = 150) or Listeria monocytogenes (r/m = 85) . For membrane proteins like mnhF2:

  • HGT appears to play a less prominent role in diversification compared to other bacterial species

  • Most genetic exchange would occur within clades rather than between them

  • Plasmids, which vary among isolates, represent an alternative mechanism for introducing genetic novelty

Methodologically, researchers should:

  • Use comparative genomics to analyze mnhF2 sequence conservation across diverse isolates

  • Apply phylogenetic approaches to detect potential HGT events affecting mnhF2

  • Compare evolutionary rates of mnhF2 to other membrane proteins to identify selection pressures

What experimental challenges arise when studying mnhF2 functionality in different environmental contexts?

Studying mnhF2 functionality across the diverse environments inhabited by S. saprophyticus presents several methodological challenges:

  • Creating representative laboratory conditions for each environmental niche

  • Developing assays sensitive enough to detect subtle functional differences

  • Accounting for the interaction of mnhF2 with other cellular components

Recommended experimental approaches include:

  • Heterologous expression systems coupled with ion flux assays

  • Development of fluorescent reporter systems to monitor transport activity in real-time

  • Creation of environmental mimicry systems that replicate conditions from various niches

  • Employment of reconstituted liposome systems to study isolated transporter function

What are the optimal protocols for recombinant expression of mnhF2 from S. saprophyticus?

When expressing recombinant mnhF2, researchers should consider:

  • Expression system selection:

    • E. coli systems may be suitable for initial characterization but may lack proper folding machinery

    • Gram-positive hosts like B. subtilis might provide better membrane insertion

    • S. aureus expression systems might offer the most compatible cellular environment

  • Membrane protein purification strategy:

    • Detergent screening is critical for maintaining stability

    • Consider native vs. denatured purification approaches based on experimental needs

    • Fusion tags should be optimized for membrane protein expression (e.g., His-tags at C-terminus)

  • Functional validation:

    • Liposome reconstitution assays for direct transport measurements

    • Complementation studies in mnhF2-deficient strains

    • Ion sensitivity phenotypic assays under varying conditions

How can genomic approaches be used to understand mnhF2 evolution in the context of S. saprophyticus population structure?

Given the distinct clade structure and variable recombination rates in S. saprophyticus , researchers should employ:

  • Whole genome sequencing of diverse isolates followed by:

    • Phylogenetic placement within clade structure

    • Identification of mnhF2 sequence variants

    • Analysis of selection pressures using dN/dS ratios

  • Population genetics approaches:

    • Calculation of nucleotide diversity (π) for mnhF2 compared to housekeeping genes

    • Tajima's D test to detect selection signatures

    • Haplotype network analysis to visualize evolutionary relationships

  • Comparative genomics:

    • Synteny analysis to examine conservation of genomic context around mnhF2

    • Investigation of potential mobile genetic elements near mnhF2

    • Comparison with homologous transporters in related species

How does mnhF2 function integrate with other adaptive mechanisms in S. saprophyticus?

Research indicates that S. saprophyticus employs multiple adaptive mechanisms, including the newly identified Type VII secretion system associated with bovine mastitis . Understanding how mnhF2 integrates with these systems requires:

  • Multi-omics approaches:

    • Transcriptomic analysis to identify co-regulated genes

    • Proteomic studies to detect protein-protein interactions

    • Metabolomic profiling to assess impact on cellular physiology

  • Systematic phenotypic characterization:

    • Growth studies under various environmental stressors

    • Competitive fitness assays in mixed cultures

    • Survival rates in host-mimicking conditions

Such integrated approaches can reveal whether mnhF2 functions independently or as part of broader adaptive networks that enable S. saprophyticus to thrive as a bacterial generalist across diverse environments.

What bioinformatic pipelines are most effective for studying mnhF2 in the context of bacterial adaptation?

Based on current research approaches in S. saprophyticus genomics , effective bioinformatic pipelines should include:

  • Sequence analysis tools:

    • Hidden Markov Models for identifying antiporter domains

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Homology modeling based on structurally characterized antiporters

  • Comparative genomics frameworks:

    • Pan-genome analysis tools like Roary or PIRATE

    • GWAS approaches similar to those used to identify the Type VII secretion system

    • ClonalFrameML for recombination detection

  • Visualization and integration:

    • Phylogenetic visualization with metadata integration

    • Protein structure prediction and visualization

    • Metabolic network mapping to connect transport function with metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.