Recombinant Staphylococcus saprophyticus subsp. saprophyticus Putative antiporter subunit mnhG2 (mnhG2)

Shipped with Ice Packs
In Stock

Description

General Information

mnhG2 is a subunit of a multisubunit Na+/H+ antiporter found in Staphylococcus aureus, which by similarity, applies to Staphylococcus saprophyticus . These antiporters, including Mnh1 and Mnh2, are crucial for maintaining cytoplasmic pH, enabling bacteria to survive under extreme environmental stresses .

Function and Structure

  • Antiporter Activity: mnhG2 is part of a complex that facilitates the exchange of cations (like Na+ or K+) and protons (H+) across the cell membrane . This activity is vital for maintaining proper pH and osmotic balance within the bacterial cell .

  • Multisubunit Complex: It is believed that mnhG2 may form a heterooligomeric complex consisting of seven subunits: mnhA2, mnhB2, mnhC2, mnhD2, mnhE2, mnhF2, and mnhG2 . These subunits likely work together to create a functional antiporter .

  • Location: As a membrane-bound protein subunit, mnhG2 is located in the cell membrane . Its hydrophobic nature helps it to integrate into the lipid bilayer of the membrane .

Role in Staphylococcus aureus

Staphylococcus aureus has two Mnh antiporters, Mnh1 and Mnh2, which are type 3 cation/proton antiporters . Research indicates that these antiporters contribute to:

  • Salt Tolerance: Mnh1 plays a significant role in maintaining halotolerance (salt tolerance) at pH 7.5 . Mnh2 has catalytic antiporter activities for Na+/H+ and K+/H+, which have roles in both osmotolerance and halotolerance in S. aureus .

  • Alkali Tolerance: Mnh antiporters enable the bacterium's survival under extreme environmental stress .

  • Pathogenesis: Studies involving a murine infection model have revealed that MnhA1, a subunit of Mnh1, plays a major role in S. aureus virulence .

mnhG2 in Biofilm Formation and Genetic Context

  • Biofilm Production: S. saprophyticus isolates exhibit a high rate of biofilm production, suggesting that biofilm formation is a primary mode of living for these bacteria .

  • ica Gene Cluster Acquisition: S. saprophyticus can acquire the ica gene cluster, which is involved in biofilm formation, from other coagulase-negative staphylococci . The ica genes in S. saprophyticus appear to have been acquired from different CoNS species and inserted in various chromosomal locations .

Relevance to Staphylococcus saprophyticus Infections

Staphylococcus saprophyticus is a common cause of uncomplicated urinary tract infections (UTIs), particularly in young, sexually active women . Its ability to form biofilms contributes to its colonization and persistence in the urinary tract .

Functional Loss of Mnh1 or Mnh2

Experiments with S. aureus Newman, using a murine infection model, have assessed the effects of functional loss of Mnh1 or Mnh2. Mnh1 plays a major role in S. aureus virulence .

Catalytic Properties

Mnh1 exhibits catalytic activity for Na+/H+ antiport, functioning optimally at pH 7.5 . Mnh2 exhibits Na+/H+ antiport activity comparable to that of Mnh1 at pH 7.5, with either succinate or ATP establishing the proton motive force (PMF) that energizes the exchange . Mnh2 also carries out K+/H+ antiport activity .

Tables

Table 1. ica gene similarity in Staphylococcus saprophyticus and other staphylococcal species

GeneSpeciesNucleotide Identity (%)
icaA_2Staphylococcus fleurettii≥ 99.7%
icaD_2Staphylococcus fleurettii≥ 99.7%
icaB_2Staphylococcus fleurettii≥ 99.7%
icaC_4Staphylococcus fleurettii≥ 99.7%
icaR_1Staphylococcus fleurettii≥ 99.7%
icaADBCStaphylococcus cohnii≥ 98%

Table 2. Functional Characteristics of Mnh1 and Mnh2 Antiporters in Staphylococcus aureus

AntiporterPrimary ActivityOptimal pHRole
Mnh1Na+/H+7.5Halotolerance, Virulence
Mnh2Na+/H+, K+/H+9.0Osmotolerance, Halotolerance

Protein Structures

Proteins have different levels of structure that are important for their functions :

  • Primary Structure: This is the amino acid sequence of the polypeptide chain .

  • Secondary Structure: Local folding patterns like α-helices and β-pleated sheets, stabilized by hydrogen bonds . In an α helix, hydrogen bonds form between the carbonyl oxygen of one amino acid and the amino hydrogen of an amino acid four residues down the chain . In a β pleated sheet, hydrogen bonds connect two or more aligned segments of the polypeptide chain .

  • Tertiary Structure: The three-dimensional structure of the protein, influenced by chemical interactions between R groups, including hydrogen bonds, ionic bonds, hydrophobic interactions, and disulfide bridges .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mnhG2; mrpG2; SSP2090; Putative antiporter subunit mnhG2; Mrp complex subunit G2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
mnhG2
Target Protein Sequence
MQITSEIVNLIAAIMIFLGSIIALISSIGLIKFQDVFLRSHAATKSSTLSVLLTLVGVII FFISSQGYLSVRLILALVFINLTSPVGGHLISRAAYRTGAYMYRKSDAPRQTNILLSSSE NNTFEQLKQRAHEREERRRKTYEKEHDY
Uniprot No.

Target Background

Database Links

KEGG: ssp:SSP2090

STRING: 342451.SSP2090

Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Putative antiporter subunit mnhG2 in Staphylococcus saprophyticus and what is its primary function?

The mnhG2 protein in S. saprophyticus functions as a putative antiporter subunit, likely involved in ion exchange across bacterial membranes. It belongs to the Mrp (Multiple resistance and pH adaptation) complex, which typically mediates Na+/H+ exchange to maintain pH homeostasis and ion balance. Based on homology to similar proteins in S. aureus, mnhG2 contains approximately 145 amino acids and features multiple transmembrane domains characteristic of membrane transport proteins . The protein likely contributes to bacterial survival under varying environmental conditions, consistent with S. saprophyticus's demonstrated adaptability across diverse ecological niches .

How does the amino acid sequence of mnhG2 compare between S. saprophyticus and other Staphylococcus species?

The mnhG2 protein shows sequence conservation across Staphylococcus species, with notable similarities to the homologous protein in S. aureus. The S. aureus mnhG2 sequence (as a reference point) contains characteristic hydrophobic regions consistent with membrane-spanning domains: "MEITKEIFSLIAAVIMLLLGSFIALISA IGIVKFQDVFLRSHAATKSST LSVLLTLIGVLIYFIVNTGFFS VRLLLSLVFINLTSPVGMHLVA RAAYRNGAYMYRKNDAHTHAS ILLSSNEQNSTEALQLRAEKRE EHRKKWYQND" . Comparative genomic analyses suggest that while core functions are preserved, specific adaptations may exist in S. saprophyticus that contribute to its generalist lifestyle and ability to thrive in diverse environments .

What is the genetic context of the mnhG2 gene in the S. saprophyticus genome?

The mnhG2 gene in S. saprophyticus is likely part of an operon encoding multiple components of the Mrp antiporter complex. Genomic analyses of S. saprophyticus have revealed two major clades with distinct gene content and recombination patterns . The mnhG2 gene would be found within the core genome, as ion transport systems are essential for bacterial survival. The genomic context may vary between the two major clades of S. saprophyticus, which show differences in their pangenome structure and horizontal gene transfer patterns .

What are the optimal conditions for expressing recombinant mnhG2 protein from S. saprophyticus?

Methodological Answer:
Successful expression of recombinant mnhG2 requires careful optimization due to its membrane protein nature. A recommended approach involves:

  • Vector Selection: pET-based expression systems with inducible promoters offer controlled expression.

  • Host Selection: E. coli strains C41(DE3) or C43(DE3) are preferred for membrane protein expression.

  • Expression Conditions:

    • Growth temperature: 18-25°C (reduced temperature minimizes inclusion body formation)

    • Induction: 0.1-0.5 mM IPTG

    • Post-induction time: 12-16 hours

Expression Optimization Parameters:

ParameterStandard ConditionOptimization RangeNotes
Temperature20°C16-30°CLower temperatures reduce aggregation
IPTG Concentration0.2 mM0.05-1.0 mMTitrate for optimal expression
MediaLBTB, 2YT, M9Rich media may improve yields
OD600 at Induction0.6-0.80.4-1.2Affects final yield and solubility

Detergent screening is critical for membrane protein solubilization, with DDM (n-Dodecyl β-D-maltoside) and LMNG (Lauryl maltose neopentyl glycol) being good initial candidates .

What purification strategies are most effective for obtaining high-quality recombinant mnhG2 protein?

Methodological Answer:
A multi-step purification strategy is recommended for obtaining high-purity mnhG2:

  • Membrane Preparation:

    • Harvest cells and disrupt by sonication or French press

    • Separate membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize membranes with appropriate detergent (1% DDM or LMNG)

  • Chromatography Sequence:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Size exclusion chromatography (SEC)

    • Optional: Ion exchange chromatography for higher purity

  • Buffer Optimization:

    • Maintain detergent concentration above CMC throughout purification

    • Include stabilizing agents (glycerol 10-20%)

    • Buffer composition: Tris-HCl (50 mM, pH 7.5-8.0), NaCl (150-300 mM)

Storage conditions should include 50% glycerol at -20°C for extended stability, with aliquoting to avoid repeated freeze-thaw cycles .

What functional assays can verify the activity of purified recombinant mnhG2?

Methodological Answer:
Several complementary approaches can assess mnhG2 functionality:

  • Proteoliposome-Based Ion Transport Assays:

    • Reconstitute purified mnhG2 into liposomes

    • Load liposomes with pH-sensitive or ion-sensitive fluorescent dyes

    • Monitor fluorescence changes upon addition of ion gradients

  • Electrophysiological Measurements:

    • Incorporate protein into planar lipid bilayers

    • Measure ion currents under voltage-clamp conditions

    • Determine ion selectivity through ion substitution experiments

  • Complementation Assays:

    • Express mnhG2 in bacterial strains deficient in Na+/H+ antiporters

    • Test growth under high salt or alkaline conditions

    • Quantify restoration of growth phenotypes

  • Binding Assays for Substrate Interaction:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence-based ligand binding assays

These approaches should be combined with appropriate controls, including inactive mutants and related antiporter proteins, to validate specificity .

How conserved is the mnhG2 gene across different isolates of S. saprophyticus, and what does this suggest about its evolutionary importance?

Comparative genomic analyses of 780 S. saprophyticus genomes reveal that core genome components, likely including the mnhG2 gene, show moderate conservation across isolates. The species has been found to have an r/m (recombination to mutation) ratio of approximately 1.2, similar to S. aureus . This relatively low rate of horizontal gene transfer suggests that core functions like ion transport are largely maintained through vertical inheritance rather than frequent recombination.

The genomic data indicates that S. saprophyticus exists in two major clades with distinct gene content and recombination patterns . Analysis would likely reveal subtle variations in the mnhG2 sequence between these clades, potentially reflecting adaptations to different environmental niches. The conservation of this gene across diverse isolates from human, animal, food, and environmental sources suggests it plays a fundamental role in bacterial physiology regardless of habitat .

The evolutionary trajectory of mnhG2 appears to align with S. saprophyticus's generalist lifestyle, allowing it to maintain core physiological functions while adapting to diverse environments .

What genomic signatures suggest adaptation of mnhG2 function in different ecological niches of S. saprophyticus?

Genome-wide association studies (GWAS) of S. saprophyticus isolates from diverse sources (human, animal, built environment, food, and natural environment) have revealed distinct genomic signatures associated with adaptation to specific niches . While most S. saprophyticus strains appear to be generalists capable of moving between environments, specific adaptations have been observed in isolates from built environments and those causing bovine mastitis .

Potential adaptations in the mnhG2 gene might include:

  • Sequence variations: Subtle amino acid substitutions that optimize protein function for specific environmental conditions (pH, ion concentrations)

  • Regulatory differences: Changes in promoter regions that alter expression patterns in response to environmental cues

  • Interaction partners: Co-evolution with other components of the Mrp complex or associated proteins

The limited horizontal gene transfer between the two major clades of S. saprophyticus (as evidenced by FastGear analysis) suggests that any specialized adaptations in membrane transport systems like mnhG2 likely evolved independently within each clade .

How do differences in restriction-modification systems between S. saprophyticus clades potentially impact recombinant mnhG2 expression?

The two major clades of S. saprophyticus show significant differences in their restriction-modification systems (RMS) , which has important implications for recombinant protein expression strategies. RMS function as bacterial immune systems by eliminating foreign DNA based on methylation patterns, potentially creating barriers to horizontal gene transfer between clades .

For researchers working with recombinant mnhG2, these differences necessitate specific considerations:

  • Expression vector design: Vectors may need to be modified to avoid restriction sites recognized by the RMS of the source strain

  • Host selection: Expression hosts with compatible methylation patterns may improve transformation efficiency

  • Methylation treatment: Pre-methylation of expression constructs might be necessary to avoid degradation

The observed reproductive isolation between clades, with rare recombination events between them , suggests that mnhG2 variants from different clades might have evolved distinct properties that could affect heterologous expression efficiency.

What structural features of mnhG2 are critical for its antiporter function, and how can they be investigated experimentally?

While no crystal structure specifically of S. saprophyticus mnhG2 has been reported, structural insights can be gained through comparison with related proteins and predictive approaches. Based on homology to other antiporter subunits, mnhG2 likely contains multiple transmembrane helices that form ion translocation pathways. Critical structural features would include:

  • Ion binding sites: Coordinated by charged or polar amino acids

  • Conformational change regions: Flexible domains that undergo rearrangement during transport

  • Subunit interaction interfaces: Regions that mediate assembly with other Mrp complex components

Experimental Investigation Approaches:

TechniqueApplicationResolutionLimitations
X-ray CrystallographyHigh-resolution structure determination1.5-3.0 ÅRequires crystal formation
Cryo-EMStructure of entire Mrp complex2.5-4.0 ÅSample preparation challenges
Site-Directed MutagenesisFunctional validation of key residuesResidue-levelIndirect structural information
Hydrogen-Deuterium Exchange MSConformational dynamicsPeptide-levelLimited spatial resolution
Disulfide CrosslinkingProximity mappingResidue-levelRequires cysteine-free background

The crystal structure methodology successfully employed for S. equorum MnSOD provides a template for structural studies of other Staphylococcal membrane proteins, potentially including mnhG2.

How does mnhG2 interact with other components of the Mrp antiporter complex, and what methods can elucidate these interactions?

The mnhG2 protein likely functions as part of the multi-subunit Mrp antiporter complex, with interactions between subunits critical for proper assembly and function. These interactions can be investigated through:

  • Co-immunoprecipitation (Co-IP): Pull-down assays using tagged mnhG2 to identify interacting partners

  • Bacterial Two-Hybrid Systems: In vivo screening for protein-protein interactions

  • Cross-linking Mass Spectrometry: Identification of residues in close proximity between subunits

  • Blue Native PAGE: Analysis of intact membrane protein complexes

  • FRET/BRET Assays: Real-time monitoring of protein interactions in native-like environments

The proper assembly of the Mrp complex is likely critical for S. saprophyticus survival across diverse environments, consistent with its generalist lifestyle . Mutations affecting these interactions could potentially impact bacterial fitness in specific niches, such as during urinary tract infection or environmental persistence.

What is the potential role of mnhG2 in S. saprophyticus pathogenesis during urinary tract infections?

S. saprophyticus is a significant cause of community-acquired urinary tract infections (UTIs), particularly in young, sexually active females, accounting for 10-20% of UTI cases . The mnhG2 protein, as part of the Mrp antiporter complex, likely contributes to pathogenesis through several mechanisms:

  • pH Adaptation: The urinary tract presents a challenging pH environment that requires effective pH homeostasis mechanisms

  • Osmotic Stress Response: Ability to maintain ion balance in the hyperosmotic urine environment

  • Biofilm Formation: Ion transport systems may contribute to the establishment of biofilms on urinary epithelium

  • Persistence Factors: Adaptation to low-nutrient conditions during infection

The generalist nature of S. saprophyticus suggests that mnhG2 may be part of a core set of proteins that enable the bacterium to transition between environmental reservoirs and the human urinary tract. Unlike dedicated pathogens with specialized virulence factors, S. saprophyticus may rely on these adaptability mechanisms for opportunistic infections.

How might inhibition of mnhG2 function impact S. saprophyticus viability and virulence?

Targeting mnhG2 for antimicrobial development presents an interesting research avenue. As an ion transport protein likely essential for pH homeostasis, inhibition could potentially:

  • Disrupt pH Regulation: Render bacteria susceptible to pH fluctuations in the urinary environment

  • Impair Energy Metabolism: Interfere with the proton motive force necessary for ATP synthesis

  • Reduce Stress Tolerance: Decrease bacterial survival under osmotic and ionic stress conditions

  • Limit Biofilm Formation: Potentially reduce adhesion and biofilm development during infection

Experimental Approaches to Test Inhibition Effects:

ApproachMethodologyExpected OutcomesLimitations
Gene KnockoutCRISPR/Cas9 or allelic replacementViability and fitness assessmentPotential lethality
Conditional ExpressionInducible promotersControlled depletion studiesLeaky expression
Small Molecule ScreeningHigh-throughput compound librariesIdentification of inhibitorsSpecificity challenges
Peptide InhibitorsDesigned to disrupt protein-protein interactionsComplex assembly interferenceDelivery barriers

The potential for mnhG2 inhibitors would need to be balanced against the risk of affecting host transporters and considering the ecological role of S. saprophyticus beyond pathogenesis .

How can single-molecule techniques be applied to understand mnhG2 transport kinetics and conformational changes?

Advanced single-molecule approaches offer unprecedented insights into membrane transporter dynamics:

Methodological Implementation:

  • Single-Molecule FRET (smFRET):

    • Engineer mnhG2 with fluorophore pairs at strategic positions

    • Reconstitute labeled protein into liposomes or nanodiscs

    • Monitor real-time conformational changes during transport cycles

    • Correlate conformational states with transport activity

  • High-Speed Atomic Force Microscopy (HS-AFM):

    • Visualize topographical changes in mnhG2 under near-physiological conditions

    • Track dynamic structural rearrangements at nanometer resolution

    • Correlate structural changes with different ionic conditions

  • Electrical Recording of Single Transporters:

    • Incorporate mnhG2 into artificial membranes at low density

    • Record current fluctuations associated with individual transport events

    • Determine rate constants and energy barriers of the transport cycle

The implementation of these techniques would require careful protein engineering to maintain functionality while introducing necessary modifications for detection. Correlating single-molecule observations with bulk transport measurements would provide a comprehensive understanding of mnhG2 function .

What systems biology approaches can elucidate the role of mnhG2 in the broader context of S. saprophyticus adaptation to different environments?

Understanding mnhG2 function within the broader adaptive framework of S. saprophyticus requires integrative systems biology approaches:

  • Multi-omics Integration:

    • Transcriptomics: Determine expression patterns of mnhG2 across environmental conditions

    • Proteomics: Map protein-protein interaction networks involving mnhG2

    • Metabolomics: Identify metabolic shifts associated with mnhG2 expression changes

    • Genomics: Correlate genetic variations with environmental adaptations

  • Network Analysis:

    • Construct regulatory networks governing mnhG2 expression

    • Identify hub proteins that coordinate responses involving membrane transport

    • Model ion homeostasis as part of the bacterial stress response

  • In silico Modeling:

    • Develop mathematical models of ion transport dynamics

    • Simulate bacterial responses to environmental perturbations

    • Predict adaptive outcomes under different selective pressures

These approaches align with the understanding of S. saprophyticus as a bacterial generalist, capable of adapting to diverse environments through coordinated physiological responses rather than specialized adaptations .

How might comparative structural analysis of mnhG2 across different bacterial species inform protein engineering efforts?

Comparative structural analysis offers a foundation for rational protein engineering of mnhG2:

  • Structure-Function Relationship Mapping:

    • Identify conserved residues across species that likely maintain core function

    • Locate variable regions that might confer species-specific properties

    • Determine structural elements that contribute to stability versus flexibility

  • Engineering Strategies:

    • Stability enhancement: Introduce stabilizing mutations identified from extremophilic bacteria

    • Substrate specificity modification: Target residues in the ion binding pocket

    • Assembly optimization: Modify interfaces based on efficiently-assembling homologs

  • Experimental Validation Approaches:

    • Directed evolution with selection for desired properties

    • Activity assays under varying conditions to assess engineered variants

    • Structural validation of engineered proteins using X-ray crystallography or cryo-EM

The successful crystallization of the recombinant manganese superoxide dismutase from Staphylococcus species demonstrates the feasibility of structural studies on proteins from this genus and provides methodological insights applicable to mnhG2 engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.