Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor histidine kinase graS (graS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request as best as we can.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
graS; SSP2061; Sensor histidine kinase GraS; Glycopeptide resistance-associated protein S
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Target Names
graS
Target Protein Sequence
MANLKWFFIFLRSRIYWILWLLFLHFIFLGIAYLDYDISVYSILYIIILNIGLSVLFLIF TYLKEVKFYKHLDENIEPEALKHKSLADTPFQQEMVNYLYGQITNQKALVTHQKQQIQST EAALTDFVHDIKTPVTAMKLLIEKEQDLSRKHALLYEWSRINDMLDRQLFLTRLEYQNKD MYFEHVPLKRLVIEEIQITRYISQSKGIGYDLDFEDTLNVYTDTKWCRMMIRQVLSNAVK YSEESMIHIRALKESRHVVLEIKDEGKGISEKDLPRIFDKGFTSTSNRNNTISSGLGLYL VNHVKEKLSICVRIHSELDKGTVVKFIFPNQNEIVAKLSQNI
Uniprot No.

Target Background

Function
This protein is a member of the two-component regulatory system GraR/GraS, which plays a role in resistance against cationic antimicrobial peptides (CAMPs). GraS likely functions as a sensor protein kinase. It undergoes autophosphorylation at a histidine residue and subsequently transfers this phosphate group to GraR.
Database Links

KEGG: ssp:SSP2061

STRING: 342451.SSP2061

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of sensor histidine kinase graS in Staphylococcus saprophyticus?

Sensor histidine kinase graS functions as part of a two-component regulatory system in S. saprophyticus, primarily involved in sensing environmental stimuli and initiating appropriate cellular responses. As a membrane-bound sensor protein, graS detects specific environmental cues such as antimicrobial peptides and initiates a phosphorylation cascade that ultimately regulates gene expression through its partner response regulator. The graS system plays a crucial role in antimicrobial peptide resistance and adaptation to host environments, particularly in urinary tract infections where S. saprophyticus is a significant pathogen.

How does graS expression differ between the major clades of S. saprophyticus?

Research indicates significant genetic distinctions between major clades of Staphylococcus saprophyticus that may affect graS expression. Studies have shown that S. saprophyticus exists in genetically distinct clades (Clade 1 and Clade 2) with differences in gene content and nucleotide sequences of both core and accessory genomes . While specific data on graS expression differences between these clades is still emerging, the evidence of rare inter-clade recombination suggests potential functional divergence in regulatory systems like graS between these populations . Similar to the observed differences in lactose metabolism genes between clades, regulatory systems may show clade-specific adaptation patterns.

How do restriction-modification systems influence recombinant graS expression across different S. saprophyticus clades?

The expression of recombinant graS is significantly influenced by the distinct restriction-modification systems (RMSs) found in different S. saprophyticus clades. Research indicates that S. saprophyticus clades exhibit differences in their RMSs, which may create barriers to horizontal gene transfer and recombination between clades . When designing recombinant graS expression systems, researchers should consider clade-specific RMS profiles to optimize transformation efficiency and expression stability. Methylation patterns of plasmid DNA should be adjusted to bypass restriction barriers, potentially requiring passage through specialized E. coli strains that mimic the methylation pattern of the target S. saprophyticus clade. Additionally, codon optimization should account for clade-specific usage biases to maximize expression levels.

What experimental approaches can resolve contradictory data on graS phosphorylation states in membrane fractions?

Contradictory data on graS phosphorylation states in membrane fractions can be resolved through multiple complementary experimental approaches. First, implement phosphoproteomic analysis using high-resolution mass spectrometry with enrichment strategies specifically optimized for histidine phosphorylation. This should be combined with site-directed mutagenesis of predicted phosphorylation sites (H→A mutations) to confirm functional relevance. For kinetic analysis, develop in vitro reconstitution systems using purified graS protein in nanodiscs or liposomes to maintain native conformation. Time-resolved measurements using rapid-quench techniques can capture transient phosphorylation states. Additionally, FRET-based biosensors can monitor phosphorylation dynamics in real-time within living cells, while clade-comparative phosphorylation analysis may reveal evolutionary adaptations in signaling mechanisms.

How can the graS signaling pathway be experimentally differentiated from other histidine kinase pathways in S. saprophyticus?

Differentiating the graS signaling pathway from other histidine kinase pathways requires a multi-faceted experimental approach. Begin with selective gene knockout studies using CRISPR-Cas9 or allelic exchange specifically targeting graS while monitoring global phosphorylation patterns and transcriptional responses. Complement this with phosphotransfer profiling using purified graS protein against a library of response regulators to identify specific versus promiscuous signaling interactions. Chemical genetic approaches utilizing analog-sensitive kinase mutants can allow selective inhibition of graS activity. For pathway visualization, implement phospho-specific antibodies against graS and suspected downstream components, combined with chromatin immunoprecipitation sequencing (ChIP-seq) of the cognate response regulator to map the complete regulon. Cross-species comparative analysis can highlight conserved versus species-specific pathway components.

What are the optimal conditions for expressing recombinant graS protein while maintaining native conformation?

Expressing recombinant graS protein with native conformation requires careful optimization of several parameters. For expression systems, use either E. coli C43(DE3) or BL21(DE3) pLysS strains specifically designed for membrane proteins, or consider Lactococcus lactis for a gram-positive expression environment. The expression vector should incorporate a mild promoter system (e.g., pBAD or tightly controlled T7) to prevent inclusion body formation, with C-terminal tagging preferred to avoid interference with membrane integration of the N-terminal domain.

Optimization protocol:

  • Culture at reduced temperatures (18-25°C) following induction

  • Use low inducer concentrations (0.1-0.5 mM IPTG or 0.002-0.02% arabinose)

  • Include membrane-stabilizing additives (glycerol 5-10%, specific lipids)

  • Supplement with specific cofactors (ATP, Mg²⁺) during expression

For extraction and purification, utilize gentle detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their CMC values. Implementation of size-exclusion chromatography as a final purification step can separate properly folded protein from aggregates. Verification of native conformation should include circular dichroism spectroscopy, thermal shift assays, and ligand binding studies.

What laboratory-scale methods can accurately assess graS activity in different environmental conditions?

Laboratory-scale methods for assessing graS activity across different environmental conditions require both in vitro and in vivo approaches. For high-throughput screening, develop a fluorescence-based reporter system using the graRS promoter region fused to GFP or luciferase to monitor activation under various conditions. This can be complemented with a FRET-based sensor measuring the interaction between graS and graR components.

For detailed mechanistic studies, implement:

  • In vitro autophosphorylation assays using [γ-³²P]ATP with purified graS in membrane mimetics

  • Phosphotransfer profiling to graR using time-course experiments

  • Surface plasmon resonance (SPR) to measure binding kinetics of potential ligands

Small-scale bioreactor systems can simulate changing environmental parameters (pH, ionic strength, antimicrobial peptide concentrations) while monitoring graS activity in real-time. The Gras Laboratory approach of replicating large-scale conditions in controlled small-scale environments is particularly applicable here . This methodology allows for rapid iterations and adjustments crucial for understanding the environmental responsiveness of graS while minimizing sample requirements.

How should researchers address discrepancies between genomic and proteomic data in graS expression studies?

Addressing discrepancies between genomic and proteomic data in graS expression studies requires a systematic multi-omics integration approach. First, implement a temporal analysis framework comparing transcriptomic and proteomic data across multiple time points to identify potential delays between transcription and translation. Utilize the GRAS balancing method (Generalized RAS) to reconcile quantitative differences between datasets, as this mathematical approach is specifically designed to handle matrices with both positive and negative elements .

When analyzing discrepancies, consider:

  • Post-transcriptional regulatory mechanisms (small RNAs, riboswitches)

  • Protein stability and degradation rates

  • Technical biases in detection methods

  • Membrane protein-specific extraction efficiency issues

For statistical validation, implement:

  • Bayesian data integration models that incorporate prior knowledge about membrane protein expression dynamics

  • Cross-platform normalization techniques

  • Simulation studies to estimate the impact of technical variability

The integration process should follow this workflow:

  • Apply platform-specific normalization

  • Perform correlation analysis between platforms

  • Identify statistically significant discrepancies

  • Develop testable hypotheses explaining observed differences

  • Design targeted validation experiments focusing on specific regulatory mechanisms

What emerging technologies will advance graS research in the next five years?

The next five years will see several transformative technologies advancing graS research. Cryo-electron microscopy will increasingly allow visualization of graS in different conformational states at near-atomic resolution, potentially revealing the structural basis for signal detection and transmission. AlphaFold and related AI structure prediction tools will provide increasingly accurate models of graS-graR interactions and complex formation dynamics.

CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems optimized for S. saprophyticus will enable precise temporal control of graS expression without permanent genetic alterations. Single-cell technologies will reveal population heterogeneity in graS activity, potentially identifying persister cell formation mechanisms related to antimicrobial resistance. Microfluidic organ-on-chip platforms incorporating human urinary tract tissues will allow study of graS function during host-pathogen interactions in physiologically relevant conditions.

Long-read sequencing technologies will improve understanding of genomic context and strain variation in graS systems across clinical isolates. Finally, small-scale testing methodologies demonstrated by laboratories like the Gras Laboratory will facilitate efficient translation of foundational research to practical applications, enabling better strategies to combat S. saprophyticus infections .

How might research on graS in S. saprophyticus inform therapeutic approaches for urinary tract infections?

Research on graS in S. saprophyticus has significant potential to inform novel therapeutic approaches for urinary tract infections (UTIs). As a key regulatory system involved in antimicrobial peptide resistance, graS represents a promising target for combination therapies that could restore efficacy of existing antibiotics. Understanding the structural basis of graS activation could enable the development of small molecule inhibitors that specifically block its signaling function, effectively disarming the bacterium's defense mechanisms.

Comparative analysis between S. saprophyticus clades with different virulence profiles may reveal how graS contributes to pathogenesis in the urinary tract environment . This could lead to clade-specific therapeutic approaches, particularly important given evidence that inter-clade recombination is rare, suggesting stable evolutionary trajectories that might respond differently to interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.